KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101125007Help
Entry
101125007         CDS       T02442                                 

Gene name
PLCE1
Definition
(RefSeq) phospholipase C epsilon 1
  KO
K05860  phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00562  Inositol phosphate metabolism
ggo01100  Metabolic pathways
ggo04014  Ras signaling pathway
ggo04015  Rap1 signaling pathway
ggo04020  Calcium signaling pathway
ggo04024  cAMP signaling pathway
ggo04070  Phosphatidylinositol signaling system
ggo04919  Thyroid hormone signaling pathway
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo05205  Proteoglycans in cancer
Module
ggo_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101125007 (PLCE1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    101125007 (PLCE1)
   04015 Rap1 signaling pathway
    101125007 (PLCE1)
   04020 Calcium signaling pathway
    101125007 (PLCE1)
   04070 Phosphatidylinositol signaling system
    101125007 (PLCE1)
   04024 cAMP signaling pathway
    101125007 (PLCE1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101125007 (PLCE1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    101125007 (PLCE1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101125007 (PLCE1)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101125007 (PLCE1)
Membrane trafficking [BR:ggo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101125007 (PLCE1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101125007 (PLCE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y RasGEF RA C2 EF-hand_like
Motif
Other DBs
NCBI-GeneID: 101125007
NCBI-ProteinID: XP_018890809
Ensembl: ENSGGOG00000007807
Position
10
AA seq 1809 aa AA seqDB search
MMLKERQPGPSVANSNALPSSSAGISKELIDLQPLIQFPEEVASILMEQEQTIYRRVLPV
DYLCFLTRDLGTPECQSSLPCLKASISASILTTQNGEHNALEDLVMRFNEVSSWVTWLIL
TAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMDQSDIETMRS
LKDAMAQHESSCEYRKVVTRALHIPGCKVVPFCGVFLKELCEVLDGASGLMKLCPQYNSQ
EETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQVIRSCNRSLETDEEDSPSEGN
SSRKSSLKDKSRWQFIIGDLLDSDNDIFEQSKEYDSHGSEDSQKAFDHGTELIPWYVLSI
QADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWVKPTTASPASSKAKLGVLNN
TAEPGKFPLLGNAGLSSLTEGVLDLFAVKAVYMGHPGIDIHTVCVQNKLGSMFLSETGVT
LLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTRAVRKMRKFPDQRQQWLRKQYVSLYQE
DGRYEGPTLAHAVELFGGRRWSARNPSPGTSAKNAEKPNMQRNNTLGISTTKKKKKILMR
GESGEVTDDEMATRKAKMHKECRSRSGSDPQDINEQEESEANAIANPPNPLPSRRAHSLT
TAGSPNLAAGTSSPIRPVSSPVLSSSNKSPSSAWSSSSWHGRIKGGMKGFQSFMVSDSNM
SFVEFVELFKSFSVRSRKDLKDLFDVYAVPCNRSGSESAPLYTNLTIDENTSDLQPDLDL
LTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLGIFGVGILQLNDFL
VNCQGEHCTYDEILSIIQKFEPSISMCHQGLMSFEGFARFLMDKENFASKNDESQENIKE
LQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPIIYHG
HTLTTKIPFKEVVEAIDRSAFINSDLPIIISIENHCSLPQQRKMAEIFKTVFGEKLVTKF
LFETDFSDDPMLPSPDQLRRKVLLKNKKLKAHQTPVDILKQKAHQLASMQAQAYNGGNAN
PPPANNEEEEDEEDEYDYDYESLSDDNILEDRPENKSCNDKLQFEYNEEIPKRIKKADNS
ACNKGKVYDMELGEEFYLDQNKKESRQIAPELSDLVIYCQAVKFPGLSTLNASGSSRGKE
RKSRKSIFGNNPGRMSPGETASFNKTSGKSSCEGIRQTWEESSSPLNPTTSLSAIIRTPK
CYHISSLNENAAKRLCRRYSQKLIQHTACQLLRTYPAATRIDSSNPNPLMFWLHGIQLVA
LNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKNCPMYQKFSPLERDLDSMDPAVYSL
TIVSGQNVCPSNSMGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFRVHFEDL
VFLRFAVVENNSSVVTAQRIIPLKALKRGYRHLQLRNLHNEVLEISSLFINSRRMEENSS
GNTMSASSMFNTEERKCLQTHRVTVHGVPGPEPFTVFTINGGTKAKQLLQQILTNEQDIK
PVTTDYFLMEEKYFISKEKNECRKQPFQRAIGPEEDIMQILSSWFPEEGYVGRIVLKTQQ
ENLEEKNIVQDDKEVILSSEEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQTLCKAK
YSYSILSNPNPSDYVLLEEVVKDTTNKKTTTPKSSQRVLLDQECVFQAQSKWKGAGKFIL
KLKEQVQASREDKKKGISFASELKKLTKSTKQPRGLTSPSQLLTSESIQTKEEKPMGGLS
SSDTMDYRQ
NT seq 5430 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgaaagaacgccagccaggcccctctgtggccaattccaatgccctcccttca
agttcagctgggatcagcaaggagctgatcgatctgcagcctctcatccagttcccagag
gaagtcgccagcatcctgatggagcaagagcagactatttaccgcagggtcttgccagtt
gactacctttgcttcttaacacgggacttgggcactcctgaatgccagagctccttgccc
tgcctcaaagcatccatctcagcgtcaattcttaccactcagaatggagagcacaatgcc
cttgaagatctggtgatgaggtttaatgaggtgagctcctgggtgacatggctgatcctc
acggcaggctccatggaggagaagcgagaagtcttttcatatttggtgcatgtggccaaa
tgctgctggaacatgggcaactacaatgctgtcatggagttcttggctggcctcaggtca
agaaaagttttaaaaatgtggcagttcatggaccagtctgatattgagaccatgaggagc
ctgaaggatgctatggcccagcatgagtcctcttgtgagtacagaaaggtggtgacacgt
gccctgcacatccctggctgtaaggtggttccattctgtggggtgtttctgaaggagctc
tgtgaagtgcttgacggcgcctctggcctcatgaagctttgcccgcagtacaattcccaa
gaagaaactttagagtttgtagcagattacagtggacaagataatttcttacaacgagtg
ggacaaaatggcttaaagaattcggagaaggagtccactgtcaacagcatctttcaggtc
atccggagctgcaatcgaagtctggagacagacgaggaggacagccccagtgaaggaaac
agctccaggaaaagctccttgaaggataaaagccgatggcagtttataattggagatttg
ttggattcagacaatgacatctttgagcaatccaaagaatacgactctcatggttcagag
gactcacagaaggccttcgaccatgggacggagctcatcccttggtacgtgctgtccatc
caagccgatgtgcaccagttcctgctgcagggggccacagtcatccactacgaccaggac
acacacctctctgcccgctgcttcctccagcttcagcccgacaatagcaccttgacctgg
gtaaagcccacaactgcctccccagccagcagtaaagcaaaacttggtgtacttaataac
acagctgagcctggaaaattcccactactgggtaatgctggattaagtagcctgacggaa
ggggtcttggatctttttgcagtgaaggctgtatacatgggccaccctggcattgatata
cacactgtgtgtgttcagaacaaactgggtagcatgttcctgtcagagactggtgtgaca
ttgctctatgggcttcagaccacagacaacagattattgcacttcgtggcaccaaagcac
acagctaaaatgctcttcagtggattattggaactcactagagctgtgagaaagatgagg
aaattccctgaccaaagacagcagtggctgcggaaacagtacgtcagcctttatcaggag
gatggacggtatgaaggcccaactttggctcacgctgtggagttgtttggtggcagacgg
tggagtgctcgaaaccccagccctggaacatcagcaaagaatgctgagaagcccaatatg
cagagaaacaataccctgggcataagcactaccaagaaaaagaagaaaatcctcatgagg
ggtgagagtggagaggtaactgacgatgagatggcaacccgaaaggccaagatgcacaaa
gagtgtcgaagccggagtggttctgatcctcaagacattaatgaacaagaagaatcagag
gcgaatgccatcgctaaccctccaaaccccctcccttccagaagagcccactctttgacc
acagctgggtcccccaacttggctgccgggacgtcatctcccatcaggccagtgtcctcc
cctgtgctgtcttcttcaaacaagagcccatccagtgcttggagcagtagtagctggcac
gggcggatcaaaggcggcatgaagggatttcagagcttcatggtttcagatagcaacatg
agttttgttgaatttgttgagctgttcaaatcgttcagtgtcaggagccgcaaggacctg
aaggatctgtttgatgtctatgcagtgccctgcaaccgatctggctccgagtcagcccca
ctctacaccaacctgacaattgatgaaaacaccagcgatcttcagcctgacctagatctg
ttgaccagaaatgtctcggatttggggttgttcattaagagtaaacagcagctatcggac
aaccagaggcagatatctgatgccattgctgctgcaagcattgtgacaaatggcactggg
attgagagcacatctctgggcatttttggggtgggcatacttcagctcaatgatttcctc
gtgaattgccaaggagaacactgcacttatgatgaaatcctcagcatcatccagaagttc
gagcctagcatcagtatgtgtcatcagggactaatgtcatttgaagggtttgcaaggttt
ctgatggataaagaaaattttgcctcaaaaaatgatgagtcacaggagaacattaaagaa
ctgcagctacccctttcatactattacatcgaatcttcgcacaatacctacctcacgggc
catcagctcaaaggcgaatcctcggtagaactctacagccaggtccttttgcaaggctgt
cgaagtgtagaattggactgctgggacggagacgatggcatgcccatcatttatcatgga
catacgctgacaaccaagatccccttcaaggaagtggttgaagccattgatcgcagtgcc
ttcatcaactctgacctgccaatcatcatatcaattgagaaccactgttcattgcctcag
caacgaaaaatggcagaaattttcaagactgtgtttggagaaaagctggtgactaaattc
ttatttgagactgatttctcagatgatccaatgcttccttcacctgaccaactcagaagg
aaagttcttcttaaaaacaagaagctaaaagcccatcagacgccagtggatatcttaaag
caaaaggctcatcagttagcatctatgcaagcgcaggcttataatggtgggaatgccaac
cccccacctgccaataatgaggaagaagaagatgaggaggacgaatatgattatgactat
gaatccctttctgatgacaacattctggaagacagacctgaaaataaatcatgtaatgac
aagcttcagtttgaatataatgaagaaatcccaaagaggataaagaaagcagataactct
gcttgcaacaaaggaaaggtttatgatatggaactgggagaagaattttatcttgatcag
aataaaaaggaaagcagacagattgcaccagagctttctgaccttgtaatctattgtcaa
gcagtaaaatttccaggactgtcaactctaaatgcatctggctctagcagaggaaaagaa
aggaaaagcaggaagtccatttttggcaacaatccgggcagaatgagcccaggggagaca
gcatcatttaacaaaacatctggaaaaagttcctgtgaaggcattcgacagacctgggag
gaatcttcttcccctctcaacccaaccacgtccctcagtgctatcattagaactcccaaa
tgttatcatatctcgtcgctgaatgaaaatgccgccaaacgtctgtgtcgcaggtattct
cagaaactgatccagcacaccgcctgtcagctgctgagaacttaccctgctgccacccgc
atcgactcttccaacccgaaccccctcatgttctggctccatgggatacagctcgtggca
ctcaactaccagaccgatgatctccctttacatttaaatgctgcaatgtttgaggcaaat
ggtggttgtggttatgttttgaaacctccagttctgtgggacaagaactgccccatgtat
cagaagttttctccactagaaagagatctggacagcatggatcctgcagtctattcttta
actattgtctctggtcagaatgtgtgccccagtaatagcatgggaagcccatgcattgaa
gtcgacgtcctgggcatgcctctggacagctgccatttccgcacaaagcccatccatcga
aacaccctgaaccccatgtggaacgagcagtttctgttccgcgttcacttcgaagatctt
gtatttcttcgttttgcagttgtggaaaacaatagttcagtggtaactgctcagagaatc
attccactgaaagctttaaaacgaggatatcgacatcttcagctgcgaaaccttcacaat
gaagtcttggagatttctagtttattcattaacagcagaaggatggaagaaaattcctct
ggcaataccatgtcagcctcttcgatgtttaatacagaagaaagaaaatgtttgcagact
cacagagtcacggtgcatggggtcccagggccagagccctttaccgttttcactattaat
ggaggcaccaaggcaaagcagcttctgcagcaaattctgacaaatgaacaagacatcaaa
cctgttaccacagactattttttgatggaagaaaaatattttatatctaaagaaaagaat
gaatgtaggaaacaaccattccagagagccattggtccagaagaggacatcatgcaaatt
ttaagcagctggtttccagaagagggatacgtgggcaggattgtcttaaaaacccagcag
gaaaacctagaagagaaaaacattgttcaagatgacaaagaggtgatcttgagctcagag
gaggagagtttctttgtccaagtgcatgatgtttctccagagcaacctcgaacagtcatc
aaagcaccccgcgtcagcactgcacaggatgtcattcagcagaccttatgcaaagccaaa
tattcctacagcatcctgagcaaccccaatccaagcgactatgtgcttttggaagaggtg
gtgaaagacactaccaacaagaagaccaccacaccaaagtcctctcagcgggtccttctg
gatcaggagtgtgtgtttcaagcccaaagcaagtggaaaggtgcaggaaaattcatcctt
aagctaaaggagcaggtgcaggcatctcgagaagataaaaagaaaggcatttctttcgca
agtgaactcaagaagctcaccaagtcaactaaacagccccgaggacttacatcaccttct
cagctcttgacctcagaaagtatccaaaccaaggaggagaaacctatgggtggcttgtcc
tccagtgacacaatggattaccgacagtga

DBGET integrated database retrieval system