KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101125569
Entry
101125569         CDS       T02442                                 

Gene name
TRIM38
Definition
(RefSeq) E3 ubiquitin-protein ligase TRIM38
  KO
K12014  tripartite motif-containing protein 38 [EC:2.3.2.27]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ggo04121]
    101125569 (TRIM38)
Enzymes [BR:ggo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101125569 (TRIM38)
Ubiquitin system [BR:ggo04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    101125569 (TRIM38)
SSDB
Motif
Pfam: PRY SPRY zf-C3HC4_4 zf-B_box zf-RING_UBOX zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_5 U-box zf-C3HC4_2 Trm112p zf-RING_6 RDM
Other DBs
NCBI-GeneID: 101125569
NCBI-ProteinID: XP_004043414
Ensembl: ENSGGOG00000007662
UniProt: G3QXF1
Position
6
AA seq 465 aa
MASATSTKKMMEEATCSICLSLMTNPVSINCGHSYCHLCITDFFKNPSQKQLRQETFCCP
QCRAPFHMDSLRPNKQLGSLIEALKETDQEMSCEEHGEQLHLFCEDEGQLICWRCERAPQ
HKGHTTALVEDVCQGYKEKLQKAVTKLKQLEDRCTEQKLSTAMRITKWKEKVQIQRQKIQ
SDFKNLQCFLHEEEKSYLWRLEKEEQQTLSRLRDCEASLGLKSNELKSHILELEEKCQGS
AQKLLQNVNDTLSRSWAVKLETSEAVSLELHTMCNVSKLYFDVKKMLRSHQVSVTLDPDT
AHHELILSEDRRQVTRGYTQENQDTSSRRFTAFPCVLGCEGFTSGRRYFEVDVGEGTGWD
LGVCMENVQRGTGMKQEPQSGFWTLRLCKKKGYVALTSPPTSLHLHEQPLLVGIFLDYEA
GVVSFYNGNTGCHIFTFPKASFSDTLRPYFQVYQYSPLFLPPPGD
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggcctcagccaccagcaccaagaagatgatggaggaagccacctgctccatctgcctg
agcctgatgacgaacccagtaagcatcaactgtggacacagctactgccacttgtgtata
acagacttctttaaaaacccaagccaaaagcaactgaggcaggagacattctgctgtccc
cagtgtcgggctccatttcacatggatagcctccgacccaacaagcagctgggaagcctc
attgaagccctcaaagagacggatcaagaaatgtcatgtgaggaacacggagagcagctc
cacctgttctgcgaagacgaggggcagctcatctgctggcgctgtgagcgggcaccacag
cacaaagggcataccacagctcttgttgaagacgtatgccagggctacaaggaaaagctc
cagaaagctgtgacaaaattgaagcaacttgaagacagatgtacggagcagaagctgtcc
acagcaatgcgaataactaaatggaaagagaaggtacagattcagagacaaaaaatccag
tctgactttaagaatctccagtgtttcctacatgaggaagagaagtcttatctctggagg
ctggagaaagaagaacaacagactctgagtagactgagggactgtgaggctagtctgggg
ctgaagagcaatgaactcaagagccatatcctggaactggaggaaaaatgtcagggctca
gcccagaaattgctgcagaatgtgaatgacactttgagcaggagttgggctgtgaagctg
gaaacatcagaggctgtctccttggaacttcatactatgtgcaacgtttccaagctttac
ttcgatgtgaagaaaatgttaaggagtcatcaagttagtgtgactctggatccagataca
gctcatcacgaactaattctctctgaggatcggagacaagtgactcgtggatacacccag
gagaatcaggacacatcttccaggagatttactgccttcccctgtgtcttgggttgtgaa
ggcttcacctcaggaagacgttactttgaagtagatgttggcgaaggaaccgggtgggat
ttaggagtttgtatggaaaatgtgcagaggggcactggcatgaagcaagagcctcagtct
ggattctggaccctcaggctgtgcaaaaagaaaggctatgtagcacttacttctccccca
acttcccttcatctgcatgagcagcccctgcttgtgggaatttttctggactatgaggcc
ggagttgtatccttttataacgggaatactggctgccacatctttactttcccgaaggct
tccttctctgatactctccggccctatttccaggtttatcaatattctcctttgtttctg
cctcccccaggtgactaa

DBGET integrated database retrieval system