KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101125878
Entry
101125878         CDS       T02442                                 

Gene name
RDH5
Definition
(RefSeq) retinol dehydrogenase 5 isoform X1
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101125878 (RDH5)
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     101125878 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776 Birna_VP5
Other DBs
NCBI-GeneID: 101125878
NCBI-ProteinID: XP_004053363
Ensembl: ENSGGOG00000003168
UniProt: G3QKX8
Position
12
AA seq 318 aa
MWLPLLLGALLWAVLWLLRDRQSLPASDAFVFITGCDSGFGRLLALQLDQRGFRVLASCL
TPSGAEDLQRVASCRLHTTLLDITDPQSVQQAAKWVEMHVKEAGLFGLVNNAGVAGIIGP
TPWLTRDDFQRVLNVNTMGPIGVTLALLPLLQQARGRVINITSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAHFGIRVSIVEPGFFRTPVTNLESLEKTLQACWARLPPATQAHYGGA
FLTKYLKMQQRVMNLICDPDLTKVSRCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDAVLTWVLPKPAQAVY
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctcttctgctgggtgccttactctgggcagtgctgtggttactcagggac
cggcagagcctgcccgccagcgatgcctttgtcttcatcaccggctgtgactcaggcttt
gggcgccttctggcactgcagctggaccagagaggcttccgagtcctggccagctgcctg
accccctccggggccgaggacctgcagcgggtggcctcctgccgcctccacaccaccctg
ctggatatcactgatccccagagcgtccagcaggcagccaagtgggtggagatgcacgtt
aaggaagcagggctttttggtctggtgaataatgctggtgtggctggtatcatcggaccc
acaccatggctgacccgggacgatttccagcgggtgctgaatgtgaacacaatgggtccc
atcggggtcacccttgccctgctgcctctgctgcagcaagcccggggccgggtgatcaac
atcaccagcgtcctgggtcgcctggcagccaatggtgggggctactgtgtctccaaattt
ggcctggaggccttctctgacagcctgaggcgggatgtagctcattttgggatacgagtc
tccatcgtggagcctggcttcttccgaacccctgtgaccaacctggagagtctggagaaa
accctgcaggcctgctgggcacggctacctcctgccacacaggcccactatgggggggcc
ttcctcaccaagtacctgaaaatgcaacagcgcgtcatgaacctgatctgtgacccggac
ctaaccaaggtgagccgatgcctggagcatgccctgactgctcgacacccccgaacccgc
tacagcccaggttgggatgccaagctgctctggctgcctgcctcctacctgccagccagc
ctggtggatgctgtgctcacctgggtccttcccaagcctgcccaagcagtctactga

DBGET integrated database retrieval system