KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101125890
Entry
101125890         CDS       T02442                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00230  Purine metabolism
ggo01100  Metabolic pathways
ggo01522  Endocrine resistance
ggo04015  Rap1 signaling pathway
ggo04020  Calcium signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04024  cAMP signaling pathway
ggo04062  Chemokine signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04114  Oocyte meiosis
ggo04211  Longevity regulating pathway
ggo04213  Longevity regulating pathway - multiple species
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04371  Apelin signaling pathway
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04713  Circadian entrainment
ggo04714  Thermogenesis
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04727  GABAergic synapse
ggo04742  Taste transduction
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04914  Progesterone-mediated oocyte maturation
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04921  Oxytocin signaling pathway
ggo04923  Regulation of lipolysis in adipocytes
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo04976  Bile secretion
ggo05032  Morphine addiction
ggo05163  Human cytomegalovirus infection
ggo05166  Human T-cell leukemia virus 1 infection
ggo05200  Pathways in cancer
ggo05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101125890 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101125890 (ADCY4)
   04371 Apelin signaling pathway
    101125890 (ADCY4)
   04020 Calcium signaling pathway
    101125890 (ADCY4)
   04072 Phospholipase D signaling pathway
    101125890 (ADCY4)
   04024 cAMP signaling pathway
    101125890 (ADCY4)
   04022 cGMP-PKG signaling pathway
    101125890 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101125890 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101125890 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101125890 (ADCY4)
   04062 Chemokine signaling pathway
    101125890 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    101125890 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    101125890 (ADCY4)
   04912 GnRH signaling pathway
    101125890 (ADCY4)
   04913 Ovarian steroidogenesis
    101125890 (ADCY4)
   04915 Estrogen signaling pathway
    101125890 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    101125890 (ADCY4)
   04921 Oxytocin signaling pathway
    101125890 (ADCY4)
   04926 Relaxin signaling pathway
    101125890 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    101125890 (ADCY4)
   04918 Thyroid hormone synthesis
    101125890 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    101125890 (ADCY4)
   04916 Melanogenesis
    101125890 (ADCY4)
   04925 Aldosterone synthesis and secretion
    101125890 (ADCY4)
   04927 Cortisol synthesis and secretion
    101125890 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101125890 (ADCY4)
   04270 Vascular smooth muscle contraction
    101125890 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    101125890 (ADCY4)
   04971 Gastric acid secretion
    101125890 (ADCY4)
   04972 Pancreatic secretion
    101125890 (ADCY4)
   04976 Bile secretion
    101125890 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    101125890 (ADCY4)
   04727 GABAergic synapse
    101125890 (ADCY4)
   04725 Cholinergic synapse
    101125890 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    101125890 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    101125890 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    101125890 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    101125890 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    101125890 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101125890 (ADCY4)
   04714 Thermogenesis
    101125890 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101125890 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    101125890 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    101125890 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101125890 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101125890 (ADCY4)
   05163 Human cytomegalovirus infection
    101125890 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101125890 (ADCY4)
Enzymes [BR:ggo01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101125890 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N DUF3180 CD52
Other DBs
NCBI-GeneID: 101125890
NCBI-ProteinID: XP_018865769
Ensembl: ENSGGOG00000004700
UniProt: G3QPV5
Position
14
AA seq 1077 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLAVAWASGRELTSDPS
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWVALLALGHAFLFTGGVVSAWDQV
SYFLFVIFTAYAMLPLGMRDAAVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVAGVYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGLKMRPSLLMTR
YLESWGAAKPFAHLSHGDSPVSTSTPLPEKTLASFSTQWSLDRSRTPRGLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFI
IQMLVTNRPPALVITYSITFLLFLLILFVCFSEDLMRCVLKGPKMLHWLPALSGLVATRP
GLRIALGTATILLVFAMAITSLFFFPTSSDCPFQAPNVSSMISNLSWELPGSLPLISVPY
SMHCCTLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSECLIVRLYLGALDS
RPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETAWALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagcccccggccgccccccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccgctgctgctgctgctgctggggatcgtgctctgtgcg
ctcgcggcgctgctcgccgtggcctgggccagcggcagggagctgacctcagacccgagc
ttcctgaccactgtgctgtgcgcgctgggcggcttctcgctgctgctgggcctcgcttcc
cgggagcagcgactgcagcgctggacgcgtcccctgtccggcttggtatgggtcgcgctg
ctagcgctaggccacgccttcctgttcaccgggggcgtggtgagcgcctgggaccaggtg
tcctattttctcttcgtcatcttcacggcgtatgccatgctgcccttgggcatgcgggac
gccgccgtcgcgggcctcgcctcctcactctcgcatctgctggtcctcgggctgtatctt
gggccacagccggactcacggcctgcactgctgccgcagttggcagcaaacgcagtgctg
ttcctgtgcgggaacgtggcaggagtgtaccacaaggcgctgatggagcgcgccctgcgg
gccacgttccgggaggcactcagctccctgcactcacgccggcggctggacaccgagaag
aagcaccaggaacaccttctcttgtccatccttcctgcctacctggcccgagagatgaag
gcagagatcatggcacggctgcaggcaggacaggggtcacggccagagagcactaacaat
ttccacagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacgcggctggccagcgagtgttcccctaaggagctggtgctcatgctcaatgag
ctctttggcaagttcgaccagattgccaaggagcatgaatgcatgcggatcaagatcctg
ggggactgttactactgtgtctctgggctgccactctcactgccagaccatgccatcaac
tgcgtgcgcatgggcctggacatgtgccgggccatcaggaaactgcgggcagccactggc
gtggacatcaacatgcgtgtgggcgtgcactcaggcagcgtactgtgtggagtcatcggg
ctgcagaagtggcagtacgacgtttggtcccatgatgtcacactggctaaccacatggag
gcaggcggtgtaccagggcgagtgcacatcacaggggctaccctggccctgctggcaggg
gcttatgctgtggaggatgcaggcatggagcatcgggacccctaccttcgggagctaggg
gagcctacctatctggtcatcgatccacgggcagaggaggaggatgagaagggcactgca
ggaggcttgctgtcctcgcttgagggcctcaagatgcgtccatcactgctgatgacccgt
tacctggagtcctggggcgcagccaagccttttgcccacctgagccacggagacagccct
gtgtccacctccacccctctcccggagaagaccctggcttccttcagcacccagtggagc
ctggatcggagccgtaccccccggggactagatgatgaactggacaccggggatgccaag
ttcttccaggtcattgagcagctcaactcgcagaaacagtggaagcagtcgaaggacttc
aaccccctgacactgtacttcagagagaaggagatggagaaagagtaccgactctctgca
atccccgccttcaaatactatgaagcctgcaccttcctggtttttctctccaacttcatc
atccagatgctagtgacaaacaggcccccagctctggtcatcacgtatagcatcaccttc
ctcctcttcctcctcatcctttttgtctgcttctcagaggacctgatgaggtgtgtcctg
aaaggccccaagatgctgcactggctgcctgcactgtctggcctggtggccacacgacca
ggactgagaatagccttgggcaccgccaccatcctccttgtctttgccatggccattacc
agcctgttcttcttcccaacatcatcagactgccctttccaagctcccaatgtgtcctcc
atgatttccaacctctcctgggagctccctgggtctctacctctcatcagtgtcccatac
tccatgcactgctgcacgctgggcttcctctcctgctccctctttctgcacatgagcttc
gagctgaagctgctgctgctcctgctgtggctggcggcatcctgctccctcttcctgcac
tcccacgcctggctgtccgaatgcctcatcgtccgcctctatctgggcgccttggactcc
aggcccggagtgctgaaggagcccaaactgatgggtgctatctccttcttcatcttcttc
ttcaccctccttgtcctggctcgccagaatgagtactactgccgcctggacttcctgtgg
aagaagaagctgaggcaggagcgggaggagacagagacgatggagaacctgactcggctg
ctcttggagaacgtgctccctgcacacgtggccccccagttcattggccagaaccggcgc
aacgaggatctctaccaccagtcctatgaatgcgtttgtgtcctcttcgcctcagtccca
gacttcaaggagttctactctgaatccaacatcaatcatgagggcctagagtgtctgagg
ctgctcaatgagataattgctgattttgatgagctgctctccaagcccaagttcagtggg
gtggagaagatcaagaccatcggcagcacctacatggcagccacaggcttaaatgccacc
tctggacaggatgcacaacaggatgctgaacggagctgcagccaccttggcactatggtg
gaatttgccgtggccctggggtctaagctggacgtcatcaacaagcattcattcaacaac
ttccgcctgcgtgtggggttgaaccatggaccagtagtagctggagttattggggcccag
aagccgcaatatgacatttggggcaacacagtgaacgtggccagccgcatggagagtacc
ggagtccttggcaaaatccaagtgactgaggagacagcatgggccctacagtccctgggc
tacacctgctacagccggggtgtcatcaaggtgaaaggcaaagggcagctctgcacctac
ttcctgaacacagacttgacacgaactggacctccttcagctaccctaggctga

DBGET integrated database retrieval system