KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101126516
Entry
101126516         CDS       T02442                                 

Gene name
FOXL1
Definition
(RefSeq) forkhead box protein L1
  KO
K09405  forkhead box protein L
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ggo03000]
    101126516 (FOXL1)
Transcription factors [BR:ggo03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    101126516 (FOXL1)
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 101126516
NCBI-ProteinID: XP_004058153
Ensembl: ENSGGOG00000014569
UniProt: G3RF46
Position
16
AA seq 345 aa
MSHLFDPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKPPYSYIALIAM
AIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNDCFVKVPREKGRPGKG
SYWTLDPRCLDMFENGNYRRRKRKPKPGPGAPEAKRPRAETHERSAEAQPEAGSGAGGSG
PAISRLEAAPAGPSPLLDGPSPPAPLHWPGTASPNEDAGDAAQGAAAVAVGQPARTGDGP
GSPLRPASRSSPKSSDKSKSFSIDSILAGKQGQKPPSADELLGGAKPGPGGRLGASLLAA
SSSLRPPFNASLMLDPHVQGGFYQLGIPFLSYFPLQLPDTVLHFQ
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgagtcacctcttcgatccccggctgcctgccctggccgcctcgcccatgctgtatctt
tacggtcccgagagacccgggctccctctggccttcgcccccgccgctgctctagctgcc
tcgggccgggccgagaccccgcagaagcctccctacagctacatcgcgctcatcgccatg
gcgatccaggacgcgcccgagcagagggtcacgctcaacggcatctaccagttcatcatg
gaccgcttccccttctaccacgacaaccggcagggctggcagaacagcatccgccacaac
ctctcgctcaacgactgcttcgtcaaggtgccccgcgagaaagggcggccaggcaagggc
agctactggacgctggacccccgctgcctggacatgtttgagaacggcaactaccggcgc
cggaagaggaagcccaagccaggccccggggccccggaggccaagaggccccgcgccgag
acgcacgagcgcagcgcggaggcgcagccggaggcggggagcggggcagggggctcgggc
cccgcaatctcccgcctggaggcagcgcccgccggcccctctcccctcctggacggcccc
tctccgccggcgcccctccactggccggggaccgcgtccccgaacgaggacgccggtgac
gctgcccagggcgcagcggccgtggcggtcggccagccagcgcgcacaggggacggcccg
gggtcccctctgcgccccgcctcccggagctctccgaagagctccgacaagtccaagagc
ttcagcatagacagcatcctggcgggaaagcagggccagaagccgccttcagcggacgaa
ctcctagggggtgccaagcctgggcccggcggccgtctgggtgcctcgctcctggccgcc
tcctccagcctccgtccgcctttcaacgcttccctgatgctcgacccgcatgtccaaggc
ggcttttaccagctcgggatccccttcctctcctatttccccctgcagcttcccgacacg
gtactccacttccagtaa

DBGET integrated database retrieval system