KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101126522
Entry
101126522         CDS       T02442                                 

Gene name
GATA6
Definition
(RefSeq) transcription factor GATA-6
  KO
K17897  GATA-binding protein 6
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ggo03000]
    101126522 (GATA6)
Transcription factors [BR:ggo03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    101126522 (GATA6)
SSDB
Motif
Pfam: GATA-N GATA TF_Zn_Ribbon PHC2_SAM_assoc Prim_Zn_Ribbon
Other DBs
NCBI-GeneID: 101126522
NCBI-ProteinID: XP_004059281
Ensembl: ENSGGOG00000024673
UniProt: G3RZ55
Position
18
AA seq 594 aa
MALTDGGWCLPKRFGAAGADASDSRAFPAREPSTPPSPISSSSSSCSRGGERGPGGASNC
GTPQLDTEAAAGLPARSLLLSSYASHPFGAPHGPSAPGVAGPGGNLSSWEDLLLFTDLDQ
AATASKLLWSSRGAKLSPFAPEQPEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAA
AAASSPVYVPTTRVGSMLPGLPYHLQGSGSGPANHAGGAGAHPGWPQASADSPPYGGGGG
AAGGGAAGPGGAGSAAAHVSARFPYSPSPPMANGAAREPGGYAAAGSGGAGGVSGGGSSL
AAMGGREPQYSSLSAARPLNGTYHHHHHHHHHPSPYSPYVGAPLTPAWPAGPFETPVLHS
LQSRAGAPLPVPRGPSADLLEDLSESRECVNCGSIQTPLWRRDGTGHYLCNACGLYSKMN
GLSRPLIKPQKRVPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPL
AMKKEGIQTRKRKPKNINKSKTCSGNSSNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGA
GAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRQDSWCALALA
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggccttgactgacggcggctggtgcttgccgaagcgcttcggggccgcgggtgcggac
gccagcgactccagagcctttccagcgcgggagccctccacgccgccttcccccatctct
tcctcgtcctcctcctgctcccggggcggagagcggggccccggcggcgccagcaactgc
gggacgcctcagctcgacacggaggcggcggccggactcccggcccgctcgctgctgctc
agttcctacgcttcgcatcccttcggggctccccacggaccttcggcgcctggggtcgcg
ggccccgggggcaacctgtcgagctgggaggacttgctgctgttcactgacctcgaccaa
gccgcgaccgccagcaagctgctgtggtccagccgcggcgccaagctgagccccttcgca
cccgagcagccggaggagatgtaccagaccctcgccgctctctccagccagggtccggcc
gcctacgacggcgcgcccggcggcttcgtgcactctgcggccgcggcggcagcagccgcg
gcggcggccagctccccggtctatgtgcccaccacccgcgtgggttccatgctgcccggc
ctaccgtaccacctgcaggggtcgggcagtgggccagccaaccacgcgggcggcgcgggc
gcgcaccccggctggcctcaggcctcggccgacagccctccatacggcggcggaggcggc
gcggctggcggcggggccgcggggcctggcggcgctggctcggccgcggcgcacgtctcg
gcgcgcttcccctactctcccagcccgcccatggccaacggcgccgcgcgggagccggga
ggctacgcggcggcgggcagtgggggcgcgggaggcgtgagcggcggcggcagtagcctg
gcggccatgggcggccgcgagccccagtacagctcgctgtcggccgcgcggccgctgaac
gggacgtaccaccaccaccaccaccaccaccaccatccgagcccctactcgccctacgtg
ggggcgccactgacgcctgcctggccggccggacccttcgagaccccggtgctgcacagc
ctgcagagccgcgccggagccccgctcccggtgccccggggccccagtgcagacctgctg
gaggacctgtccgagagccgcgagtgcgtgaactgcggctccatccagacgccgctgtgg
cggcgggacggcaccggccactacctgtgcaacgcctgcgggctctacagcaagatgaac
ggcctcagccggcccctcatcaagccgcagaagcgcgtgccttcatcacggcggcttgga
ttgtcctgtgccaactgtcacaccacaactaccaccttatggcgcagaaacgccgagggt
gaacccgtgtgcaatgcttgtggactctacatgaaactccatggggtgcccagaccactt
gctatgaaaaaagagggaattcaaaccaggaaacgaaaacctaagaacataaataaatca
aagacttgctctggtaatagcagtaattccattcccatgactccaacttccacctcttct
aactcagatgattgcagcaaaaatacttcccccacaacacaacctacagcctcaggggcg
ggtgccccggtgatgactggtgcgggagagagcaccaatcccgagaacagcgagctcaag
tattcgggtcaagatgggctctacataggcgtcagtctggcctcgccggccgaagtcacg
tcctccgtgcgacaggattcctggtgcgccctggccctggcctga

DBGET integrated database retrieval system