KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101126559
Entry
101126559         CDS       T02442                                 

Symbol
KLF9
Name
(RefSeq) Krueppel-like factor 9
  KO
K09208  krueppel-like factor 9/13/14/16
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ggo03000]
    101126559 (KLF9)
Transcription factors [BR:ggo03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    101126559 (KLF9)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC zf-met zf-C2H2_8 zf-C2H2_6 zf-Di19 DUF5810
Other DBs
NCBI-GeneID: 101126559
NCBI-ProteinID: XP_004048160
Ensembl: ENSGGOG00000025900
UniProt: A0A2I2YB99
Position
9
AA seq 244 aa
MSAAAYMDFVAAQCLVSISNRAAVPEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTL
VTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSA
PSPLSLLHPGVAAKGKHASEKRHKCPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDC
LKKFSRSDELTRHYRTHTGEKQFRCPLCEKRFMRSDHLTKHARRHTEFHPSMIKRSKKAL
ANAL
NT seq 735 nt   +upstreamnt  +downstreamnt
atgtccgcggccgcctacatggacttcgtggctgcccagtgtctggtttccatttcgaac
cgcgctgcggtgccggagcatggggtcgctccggacgccgagcggctgcgactacctgag
cgcgaggtgaccaaggagcacggtgacccgggggacacctggaaggattactgcacactg
gtcaccatcgccaagagcttgttggacctgaacaagtaccgacccatccagaccccctcc
gtgtgcagcgacagtctggaaagtccagatgaggatatgggatccgacagcgacgtgacc
accgaatctgggtcgagtccttcccacagcccggaggagagacaggatcctggcagcgcg
cccagcccgctctccctcctccaccctggagtggctgcgaaggggaaacacgcctccgaa
aagaggcacaagtgcccctacagtggctgtgggaaagtctatggaaaatcctcccatctc
aaagcccattacagagtgcatacaggtgaacggccctttccctgcacgtggccagactgc
cttaaaaagttctcccgctcagacgagctgacccgccactaccggacccacactggggaa
aagcagttccgctgtccgctgtgtgagaagcgcttcatgaggagtgaccacctcacaaag
cacgcccggcggcacaccgagttccaccccagcatgatcaagcgatcgaaaaaggcgctg
gccaacgctttgtga

DBGET integrated database retrieval system