KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101126911
Entry
101126911         CDS       T02442                                 

Gene name
NR0B1
Definition
(RefSeq) nuclear receptor subfamily 0 group B member 1
  KO
K08562  nuclear receptor subfamily 0 group B member 1
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04927  Cortisol synthesis and secretion
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    101126911 (NR0B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ggo03000]
    101126911 (NR0B1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ggo03310]
    101126911 (NR0B1)
Transcription factors [BR:ggo03000]
 Eukaryotic type
  Zinc finger
   Cys4 Knirps/DAX 1-like
    101126911 (NR0B1)
Nuclear receptors [BR:ggo03310]
 0. Knirps / DAX like
  0B. DAX like receptor
   101126911 (NR0B1)
SSDB
Motif
Pfam: NR_Repeat Hormone_recep
Other DBs
NCBI-GeneID: 101126911
NCBI-ProteinID: XP_004063999
Ensembl: ENSGGOG00000002391
UniProt: G3QIY2
Position
X
AA seq 470 aa
MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVGREGLLGGRNV
ALLYRCCFCGKDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPCWGCSCGSDPGVGRAGL
PGERPVALLYRCCFCGEDHPRQGSILYSLLTSAKQTHVAPAAPEARPGGAWWDRSYFAQR
PGGKEALPGGRATALLYRCCFCGEDHPQQGSTLYCMPTSTNQAQAAPEERPRAPWWDTSS
GALRPVALKSPQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELA
QDRLQFETVEVSEPSMLQKILTTRWRETGGNEPLPVPTLQPHLAPPAEARKVPSASQVQA
IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHARMTHQ
GPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggcgggcgagaaccaccagtggcagggcagcatcctctacaacatgcttatgagcgcg
aagcaaacgcgcgcggctcctgaggctccagagacacggctggtggatcagtgctggggc
tgttcgtgcggcgatgagcccggggtgggcagagaggggctgctgggcgggcggaacgtg
gcgctcctgtaccgctgctgcttttgcggtaaagaccacccacggcagggcagcatcctc
tacagcatgctgacgagcgcaaagcaaacgtacgcggcaccgaaggcgcccgaggcgacg
ctgggtccgtgctggggctgttcgtgcggctctgatcccggggtgggcagagcggggctt
ccgggtgagcggcccgtggcactcctgtaccgctgctgcttttgtggtgaagaccacccg
cggcagggcagcatcctctacagcttgctcactagcgcaaagcaaacgcacgtggctccg
gcagcgcccgaggcacggccagggggcgcgtggtgggaccgctcctacttcgcgcagagg
ccagggggtaaagaggcgctaccaggcgggcgggccacggcgcttctgtaccgctgctgc
ttttgcggtgaagaccacccgcagcagggcagcaccctctactgcatgcccacgagcaca
aatcaagcgcaggcggctccggaggagcggccgagggccccctggtgggacacctcctct
ggtgcgctgcggccggtggcgctcaagagtccacaggtggtctgcgaggcagcctcagcg
ggcctgttgaagacgctgcgcttcgtcaagtacttgccctgcttccaggtgctgcccctg
gaccagcagctggtgctggtgcgcaactgctgggcgtccctgctcatgcttgagctggcc
caggaccgcttgcagttcgagactgtggaagtctcggagcccagcatgctgcagaagatc
ctcaccaccaggtggcgggagaccgggggcaacgagccactgcccgtgcccacgctgcag
ccccatttggcaccgccggcggaggccaggaaggtgccctccgcctcccaggtccaagcc
atcaagtgctttctttccaaatgctggagtctgaacatcagtaccaaggagtacgcctac
ctcaaggggaccgtgctctttaacccggacgtgccgggcctgcagtgcgtgaagtacatt
cagggactccagtggggaactcagcaaatactcagtgaacacgccaggatgacgcaccaa
gggccccatgacagattcatcgaacttaatagtacccttttcctgctgagattcatcaat
gccaatgtcattgctgaactgttcttcaggcccatcatcggcacagtcagcatggatgat
atgatgctggaaatgctctgtacaaagatataa

DBGET integrated database retrieval system