KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101127773Help
Entry
101127773         CDS       T02442                                 

Gene name
MTMR1
Definition
(RefSeq) myotubularin related protein 1
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00562  Inositol phosphate metabolism
ggo01100  Metabolic pathways
ggo04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101127773 (MTMR1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    101127773 (MTMR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ggo01009]
    101127773 (MTMR1)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     101127773 (MTMR1)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     101127773 (MTMR1)
Protein phosphatases and associated proteins [BR:ggo01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    101127773 (MTMR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM DSPc 3-PAP Y_phosphatase Myb_CC_LHEQLE Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 101127773
NCBI-ProteinID: XP_004065056
Ensembl: ENSGGOG00000005018
Position
X
AA seq 571 aa AA seqDB search
MEEAPLFPGESIKAIVKDVMYICPFMGAVSGTLTVTDFKLYFKNVERDPHFILDVPLGVI
SRVEKIGAQSHGDNSCGIEIVCKDMRNLRLAYKQEEQSKLGIFENLNKHAFPLSNGQALF
AFSYKEKFPINGWKVYDPVSEYKRQGLPNESWKISKINSNYEFCDTYPAIIVVPTSVKDD
DLSKVAAFRAKGRVPVLSWIHPESQATITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQS
HKLIIFDARQNSVADTNKTKGGGYESESAYPNAELVFLEIHNIHVMRESLRKLKEIVYPS
IDEARWLSNVDGTHWLEYIRMLLAGAVRIADKIESGKTSVVVHCSDGWDRTAQLTSLAML
MLDSYYRTIKGFETLVEKEWISFGHRFALRVGHGNDNHADADRSPIFLQFIDCVWQMTRQ
FPSAFEFNELFLITILDHLYSCLFGTFLCNCEQQRFKEDVYTKTISLWSYINSQLDEFSN
PFFVNYENHVLYPVASLSHLELWVNYYVRWNPRMRPQMPIHQNLKELLAVRAELQKRVEG
LQREVATRAISSSSERGSSPSHSATSVHTSV
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggaagaggctccacttttcccaggagaatcaattaaagccattgtgaaagatgtcatg
tatatctgcccatttatgggagcagtgagtggaaccctgacagtgacggactttaagctt
tacttcaaaaatgtcgagagggacccgcattttatccttgatgttccccttggagtgatc
agcagagttgagaagattggagcacagagccatggagacaattcctgtggtatagagata
gtgtgcaaggatatgaggaacttgcggcttgcttataaacaggaagaacagagtaaacta
gggatatttgaaaacctcaacaaacatgcatttcctctttctaacggacaggcactattt
gcattcagctataaagaaaaatttccaattaatggctggaaagtttatgatccagtatct
gaatataagagacagggcttgccaaatgagagttggaaaatatccaaaataaacagtaat
tatgagttctgtgacacctaccctgccatcattgttgtgccaactagtgtaaaagatgat
gacctttcaaaagtggcagcttttcgagcaaaaggcagagtccctgtgttgtcatggatt
catccggaaagtcaagcaacgattacccgttgcagccagccacttgtgggtcccaatgat
aagcgctgcaaagaggatgaaaaatacttgcaaacaataatggatgctaatgcacagtca
cacaagcttatcatctttgatgctcgacaaaacagtgtcgctgataccaacaagacaaag
ggtggaggatatgaaagtgaaagtgcttacccaaacgcagaacttgtgttcttggagatc
cacaacattcatgtcatgcgagagtcactacgcaaattaaaagagattgtgtacccttcg
atcgatgaggcgcggtggctctccaatgtggatgggacgcattggctggaatatataagg
atgctgcttgctggggcagtaagaattgctgataaaatagaatctgggaaaacatctgtg
gtggtgcattgcagcgacggttgggaccgaacagcccagctcacatctctggctatgcta
atgttggacagttactacaggaccattaaaggatttgaaactctcgtagaaaaggagtgg
ataagctttggacacaggtttgcactgcgagtgggccatggtaatgacaaccatgcggat
gctgaccgatctcccatatttctgcagtttattgattgtgtttggcaaatgacaaggcag
tttccttcagcattcgagtttaatgagctattcttgattacaattttggatcacctttat
agctgtctttttgggacctttttgtgcaactgtgaacagcagcgattcaaagaggatgta
tatacaaagacgatatctttatggtcgtatatcaatagccagctagacgagttttctaat
cccttctttgtgaattatgaaaaccacgtgttatatcctgttgctagtctgagtcatttg
gaattgtgggtaaactattatgtacgatggaatccacggatgagacctcagatgcccatt
caccagaatctcaaggagctgctggccgtcagggcggagctgcagaagcgtgtggagggc
ctacagcgggaggtggccacgcgcgccatctcatcctcatctgagcggggctcctcgccc
tcccactctgccacctccgtccacacctcggtctga

DBGET integrated database retrieval system