KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101127977
Entry
101127977         CDS       T02442                                 

Gene name
RNF138
Definition
(RefSeq) E3 ubiquitin-protein ligase RNF138 isoform X2
  KO
K10668  E3 ubiquitin-protein ligase RNF138 [EC:2.3.2.27]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ggo04121]
    101127977 (RNF138)
Enzymes [BR:ggo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101127977 (RNF138)
Ubiquitin system [BR:ggo04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    101127977 (RNF138)
SSDB
Motif
Pfam: zf_C2HC_14 zf-Di19 DZR_2
Other DBs
NCBI-GeneID: 101127977
NCBI-ProteinID: XP_018869607
Ensembl: ENSGGOG00000027857
Position
18
AA seq 199 aa
MRESGAHCPLCRGNVTRRERACPERALDLENIMRKFSGSCRCCAKQIKFYRMRHHYKSCK
KYQDEYGVSSIIPNFQISQDSVGNSNRSETSTSDNTETYQENTSSSGHPTFKCPLCQESN
FTRQRLLDHCNSNHLFQIVPVTCPICVSLPWGDPSQITRNFVSHLNQRHQFDYGEFVNLQ
LDEETQYQTAVEESFQVNI
NT seq 600 nt   +upstreamnt  +downstreamnt
atgagagaaagcggagcacattgtcccctatgtcgtggaaatgtgactagaagagagaga
gcatgtcctgaacgggccttagaccttgaaaatataatgaggaagttttctggtagctgc
agatgctgtgcaaaacagattaaattctatcgcatgagacatcattacaaatcttgtaag
aagtatcaggatgaatatggtgtttcttctatcattccaaactttcagatctctcaagat
tcagtagggaacagcaataggagtgaaacatccacatctgataacacagaaacttaccaa
gagaatacaagttcttctggtcatcctacttttaagtgtcccctgtgtcaagaatcaaat
tttaccagacagcgtttactggatcactgtaacagtaatcacctatttcagatagttcct
gtgacatgtcctatttgtgtgtctcttccttggggagatcctagccagattaccagaaat
ttcgttagtcatctaaatcagagacatcaatttgattatggagaatttgtgaatcttcag
ctagatgaagaaacccaatatcaaactgctgttgaagaatcttttcaagtaaacatctga

DBGET integrated database retrieval system