KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101129084Help
Entry
101129084         CDS       T02442                                 

Gene name
MAPK15
Definition
(RefSeq) mitogen-activated protein kinase 15
  KO
K19603  mitogen-activated protein kinase 15 [EC:2.7.11.24]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    101129084 (MAPK15)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101129084 (MAPK15)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101129084 (MAPK15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 101129084
NCBI-ProteinID: XP_004047697
Ensembl: ENSGGOG00000007904
UniProt: G3QY13
Position
8
AA seq 544 aa AA seqDB search
MCTAVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFRE
ITLLQEFGDHPNIISLLDVIRAENDRDIYLVFEFMDTDLNAVIRKGGLLQDVHVRSIFYQ
LLRATRFLHSGHVVHRDQKPSNVLLDANCTVKLCDFGLARSLGDLPEGPEDQAVTEYVAT
RWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSEE
DLLALGSGCRASVLHHLGSRPRQTLDALLPPDTSPEALDLLRRLLVFAPDKRLSATQALQ
HPYVQRFHCPSDEWAREADVRLRAHEGVQLSVPEYRSRVYQMILEYGGSSGTSREKGPEG
VSPSQAHMHKPRADPQLPSRTSVQGPRPRPQSSPGHDPAEHESPHAAKNVPRQNSAPLLQ
TALLGNGERPPGAKEAPPLTLSLVKPSGRGAAPSLTSQAAAQVANQALIRGDWNRGGGVR
VASAQQVPPRLPPEARPGRRMFSTSALQGAQGGARALLGGYSQAYGTICHSALGHLPLLE
GHHV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaccgcagtggaccctcgcattgtccggagatacctactcaggcggcagctcggg
cagggagcctatggcattgtgtggaaggcagtggaccggaggactggtgaggtcgtggcc
atcaagaaaatctttgatgcttttagggataagacagatgcccagagaacattccgggaa
atcacgctcctccaggagtttggggaccatcccaacatcatcagcctccttgacgtgatc
cgggcagagaacgacagggacatttacctggtgtttgagtttatggacactgacctgaac
gcagtcatccggaagggcggcctgctgcaggacgtccacgtgcgctccatcttctaccag
ctcctgcgggccacccggttcctccactcggggcacgttgtgcaccgggaccagaagccg
tccaatgtgctcctggatgccaactgcacagtgaagctgtgtgactttggcctggcccgc
tccctgggcgacctccccgaggggcctgaggaccaggccgtgacagagtacgtggccaca
cgctggtaccgagcaccggaggtgctgctctcttcacaccgatacacccttggggtggac
atgtggagtctgggttgtatcctgggggagatgctgcgggggagacccctgttcccgggc
acgtccaccctccaccagctggagctgatcctggagaccatcccaccgccatctgaggag
gacctcctggctctcggctcaggctgccgtgcctctgtactgcaccacctggggtcccgg
ccacgacagacgctggatgccctcctaccgccagacacctccccagaggccttggacctc
cttaggcgactcctggtgttcgccccggacaagcggttaagcgcgacccaggcactgcag
cacccctacgtgcagaggttccactgccccagcgacgagtgggcacgagaggcagatgtg
cggctccgggcacacgaaggggtccagctctctgtgcctgagtaccgtagccgcgtctat
cagatgatcctggagtatggaggcagcagcggcacctcgagagagaagggcccggagggt
gtctccccaagccaggcacacatgcacaaacccagagccgaccctcagctgccttctagg
acatctgtgcagggtcccagacccaggccccagagcagcccaggccatgaccccgccgag
cacgagtccccccatgcagccaagaacgttcccaggcagaactctgctcccctgctccaa
actgcactcctagggaatggggaaaggccccctggggcaaaggaagcgccccccttgaca
ctctcgctggtgaagccaagcgggaggggagctgcgccctccctgacctcccaggctgcg
gctcaggtggccaaccaggccctgatccggggtgactggaaccggggcggtggggtgagg
gtggccagcgcacaacaggtccctccccggcttcctccggaggcccggcccggccggagg
atgttcagcacctctgccttgcagggtgcccaggggggtgccagggctttgcttggaggc
tactcccaagcctacgggactatctgccactcggcactgggccacctgcccctgctggag
gggcaccatgtgtga

DBGET integrated database retrieval system