KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101132267Help
Entry
101132267         CDS       T02442                                 

Definition
(RefSeq) interleukin-37
  KO
K05485  interleukin 37
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101132267
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ggo04052]
    101132267
Cytokines and growth factors [BR:ggo04052]
 Cytokines
  Interleukins
   101132267
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1
Motif
Other DBs
NCBI-GeneID: 101132267
NCBI-ProteinID: XP_004031677
Ensembl: ENSGGOG00000027212
UniProt: A0A2I2YI20
Position
2B
AA seq 218 aa AA seqDB search
MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKF
SIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCL
YCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSRNMLESAAHPGWFICTS
CNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPREVSD
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttgtcggggagaactcaggagtgaaaatgggctctgaagactgggaaaaagat
gaaccccagtgctgcttagaagacccggctggaagccccctggaaccaggcccaagcctc
cccaccatgaattttgttcacacaagtccaaaggtgaagaacttaaacccgaagaaattc
agcattcatgaccaggatcacaaagtactggtcctggactctgggaatctcatagcggtt
ccagataaaaactacatacgcccagagatcttctttgcattagcctcatccttgagctca
gcctctgcggagaaaggaagtccgattctcctgggggtctctaaaggggagttttgtctc
tactgtgacaaggataaaggacaaagtcatccatcccttcagttgaagaaggagaaactg
atgaagctggctgcccaaaaggaatcagcacgccggcccttcatcttttatagggctcag
gtgggctcccggaacatgctggagtcggcggctcaccccggatggttcatctgcacctcc
tgcaattgtaatgagcctgttggagtgacagataaatttgagaacaggaaacacattgaa
ttttcatttcaaccagtttgcaaagctgaaatgagcccccgtgaggtcagcgattag

DBGET integrated database retrieval system