KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101132628Help
Entry
101132628         CDS       T02442                                 

Gene name
ALPP
Definition
(RefSeq) alkaline phosphatase, placental-like
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00730  Thiamine metabolism
ggo00790  Folate biosynthesis
ggo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    101132628 (ALPP)
   00790 Folate biosynthesis
    101132628 (ALPP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ggo04147]
    101132628 (ALPP)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ggo00537]
    101132628 (ALPP)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     101132628 (ALPP)
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101132628 (ALPP)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ggo00537]
 Enzymes
  101132628 (ALPP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 101132628
NCBI-ProteinID: XP_018877990
Ensembl: ENSGGOG00000005653
Position
2B
AA seq 534 aa AA seqDB search
MLGPCMLLLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIF
LGDGMGVSTVTAARILKGQKKDKLGPETFLAMDRFPYVALSKTYNVDKXVPDSAATATAY
LCGVKGNFQTIGLSAPARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTWVQHASPAGT
YAHTVNRNWYSDTNMPCSARQEGCKDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPD
DYSQGGTRLDGKNLVQEWLAKHQGARYVWNHTELMQASLDPSVTHLMGLFEPGDMKYEIH
RDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIE
RAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGY
VLKDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIA
HVMAFAACLEPYTACDLATPAGTTDAAHPGPSGVPASLPLLAGTLLLLGTATAP
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgctggggccctgcatgctgctgctgctgctgctgggcctgaggctacagctctccctg
ggcatcatcccagttgaggaggagaacccggacttctggaaccgccaggcagccgaggcc
ctgggtgccgccaagaagctgcagcctgcacagacagccgccaagaacctcatcatcttc
ctgggcgacgggatgggggtgtctacggtgacagctgccaggatcctaaaagggcagaag
aaagacaaactggggcctgagaccttcctggccatggaccgcttcccatacgtggctctg
tccaagacatacaatgtagacaaanncgtgccagacagtgcagccacagccacggcctac
ctgtgcggggtcaagggtaacttccagaccatcggcttgagtgcacccgcccgctttaac
cagtgcaacacgacacgcggcaacgaggtcatctccgtgatgaatcgggccaagaaagca
gggaagtcagtgggagtggtaaccaccacatgggtgcagcacgcctcaccagccggcacc
tatgcccacacggtgaaccgcaactggtactcggacaccaacatgccttgctcggcccgc
caggagggctgcaaggacatcgccacgcagctcatctccaacatggacattgacgtgatc
ctaggtggaggccgaaagtacatgtttcccatggggaccccagaccctgagtacccagat
gactacagccaaggtgggaccaggctggacgggaagaatctggtgcaggaatggctggcg
aagcaccagggtgcccggtacgtgtggaaccacactgagctcatgcaggcttccctggac
ccgtctgtgacccatctcatgggtctctttgagcctggagacatgaaatacgagatccac
cgagactccacgctggacccctccctgatggagatgacagaggctgccctgcgcctgctg
agcaggaacccccgcggcttcttcctcttcgtggagggtggtcgcatcgaccatggtcat
catgaaagcagggcttaccgggcactgactgagacgatcatgttcgacgacgccattgag
agggcgggccagctcaccagcgaggaggacacgctgagcctcgtcactgctgaccactcc
cacgtcttctccttcggaggctaccccctgcgagggagctccatcttcgggctggcccct
ggcaaggcccgggacaggaaggcctacacggtcctcctatacggaaacggtccaggctat
gtgctcaaggacggcgcccggccggatgttaccgagagcgagagcgggagccccgagtat
cggcagcagtcagcagtgcccctggacggagagacccacgcaggcgaggacgtggcggtg
ttcgcgcgcggcccgcaggcgcacctggttcacggcgtgcaggagcagaccttcatagcg
cacgtcatggccttcgccgcctgcctggagccctacaccgcctgcgacctggcgacccct
gccggcaccaccgacgccgcgcacccggggccgtccggggtccccgcttcgctgcctctg
ctggccgggaccctgctgctgctggggacggccactgctccctga

DBGET integrated database retrieval system