KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101132771Help
Entry
101132771         CDS       T02442                                 

Gene name
SLC9A3R2
Definition
(RefSeq) SLC9A3 regulator 2
  KO
K13358  Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Organismal Systems
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101132771 (SLC9A3R2)
Transporters [BR:ggo02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   101132771 (SLC9A3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EBP50_C PDZ PDZ_2 GRASP55_65
Motif
Other DBs
NCBI-GeneID: 101132771
NCBI-ProteinID: XP_004057034
Ensembl: ENSGGOG00000005919
UniProt: A0A2I2ZXV4
Position
16
AA seq 226 aa AA seqDB search
MVRSGSATPPAWAPGAPPRSPPHRLVQDVSGPLRELRPRLCHLRKGPQGYGFNLHSDKSR
PGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVDPE
TDEHFKRLRVTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSSRSDLPGSDKDIEDGSAWK
RDPFQESGLHLSPTAAEAKEKARATRVNKRAPQMDWNRKREIFSNF
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgctccgggagtgccacgccacctgcctgggctccaggagcccctccacggagc
ccaccccacaggctggtacaggatgtcagtgggcccctgagggagctgcgccctcggctc
tgccacctgcgaaagggacctcagggctatgggttcaacctgcatagtgacaagtcccgg
cccggccagtacatccgctccgtggacccgggctcacctgccgcccgctctggcctccgt
gcccaggaccggctcattgaggtgaacgggcagaatgtggagggactgcgccatgctgag
gtggtggccagcatcaaggcacgggaggatgaggcccggctgctggtggtggaccccgag
acagatgaacacttcaagcggcttcgggtcacacccaccgaggagcacgtggaaggtcct
ctgccgtcacccgtcaccaatggaaccagccctgcccagctcaatggtggctctgcgtgc
tcgtcccgaagtgacctgcctggttccgacaaggacattgaggatggcagtgcctggaag
cgagatcccttccaggagagcggcctccacctgagccccacggcagccgaggccaaggag
aaggctcgagccacacgagtcaacaagcgcgcgccacagatggactggaacaggaagcgt
gaaatcttcagcaacttctga

DBGET integrated database retrieval system