KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101133052
Entry
101133052         CDS       T02442                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ beta 1 chain isoform X2
  KO
K06752  MHC class II antigen
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04145  Phagosome
ggo04514  Cell adhesion molecules
ggo04612  Antigen processing and presentation
ggo04640  Hematopoietic cell lineage
ggo04658  Th1 and Th2 cell differentiation
ggo04659  Th17 cell differentiation
ggo04672  Intestinal immune network for IgA production
ggo04940  Type I diabetes mellitus
ggo05140  Leishmaniasis
ggo05145  Toxoplasmosis
ggo05150  Staphylococcus aureus infection
ggo05152  Tuberculosis
ggo05164  Influenza A
ggo05166  Human T-cell leukemia virus 1 infection
ggo05168  Herpes simplex virus 1 infection
ggo05169  Epstein-Barr virus infection
ggo05310  Asthma
ggo05320  Autoimmune thyroid disease
ggo05321  Inflammatory bowel disease
ggo05322  Systemic lupus erythematosus
ggo05323  Rheumatoid arthritis
ggo05330  Allograft rejection
ggo05332  Graft-versus-host disease
ggo05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101133052
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101133052
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101133052
   04612 Antigen processing and presentation
    101133052
   04658 Th1 and Th2 cell differentiation
    101133052
   04659 Th17 cell differentiation
    101133052
   04672 Intestinal immune network for IgA production
    101133052
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101133052
   05164 Influenza A
    101133052
   05168 Herpes simplex virus 1 infection
    101133052
   05169 Epstein-Barr virus infection
    101133052
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101133052
   05152 Tuberculosis
    101133052
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101133052
   05140 Leishmaniasis
    101133052
  09163 Immune disease
   05310 Asthma
    101133052
   05322 Systemic lupus erythematosus
    101133052
   05323 Rheumatoid arthritis
    101133052
   05320 Autoimmune thyroid disease
    101133052
   05321 Inflammatory bowel disease
    101133052
   05330 Allograft rejection
    101133052
   05332 Graft-versus-host disease
    101133052
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101133052
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101133052
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ggo04147]
    101133052
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101133052
  Exosomal proteins of epithelial cells
   101133052
  Exosomal proteins of breast milk
   101133052
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 C2-set_2 ig MHC_I
Other DBs
NCBI-GeneID: 101133052
NCBI-ProteinID: XP_004043821
Ensembl: ENSGGOG00000004252
UniProt: G3RPG3
Position
6
AA seq 261 aa
MSWKKALQIPGDLRVATVTLMLAMLSSLLAEGRDSPEDFVVQFKAMCYFTNGTERVRYVT
RYIYNREESARFDSDVGVYRAVTPQGRPDAEYWNSHKDILESTRAELDTVCRNNYEVAFR
GILQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLI
RNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGVGGFVL
GLIFLGLGLIIRQRSQKGLLH
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtcttggaagaaggctttgcagatccccggagaccttcgggtagcaactgtcaccttg
atgctggcgatgctgagctccctactggctgagggcagagactctcccgaggatttcgtg
gtccagtttaaggccatgtgctacttcaccaacgggacggagcgcgtgcgttatgtgacc
agatacatctataaccgagaggagtccgcgcgcttcgacagcgacgtgggggtgtaccgg
gcagtgacgccgcaggggcggcctgatgccgagtactggaacagccataaggacatcctg
gagagcacccgggcggagttggacacagtgtgcagaaacaactacgaggtggcgttccgc
gggatcttgcagaggagagtggagcccacagtgaccatctccccatccaggacagaggcc
ctcaaccaccacaacctgctggtctgctcggtgacagatttctatccaggccagatcaaa
gtccggtggtttcggaatgatcaggaggagacagccggcgttgtgtccaccccccttatt
aggaatggtgactggactttccagatcctggtgatgctggaaatgactccccagcgtgga
gatgtctacacctgccacgtggagcaccccagcctccagagccccatcaccgtggagtgg
cgggctcagtctgaatctgcccagagcaagatgctgagtggcgttggaggcttcgtgctg
gggctgatcttccttgggctgggccttatcatccgtcaaaggagtcagaaagggcttctg
cactga

DBGET integrated database retrieval system