KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101133261
Entry
101133261         CDS       T02442                                 

Gene name
BOLA2B
Definition
(RefSeq) bolA-like protein 2 isoform X1
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
SSDB
Motif
Pfam: BolA
Other DBs
NCBI-GeneID: 101133261
NCBI-ProteinID: XP_004057539
Ensembl: ENSGGOG00000012724
UniProt: G3RAE0
Position
Unknown
AA seq 152 aa
MASAKSLDRWKARLLEGGSTALTYALVRAEVSFPAEVAPVRQQGSVAGVRAGVVSLLGCR
SSWTAAMELSAEYLREKLQRDLEAEHVEVEDTTLNRCACSFRVLVVSAKFEGKPLLQRHR
LVNACLAEELPHIHAFEQKTLTPDQWARERQK
NT seq 459 nt   +upstreamnt  +downstreamnt
atggcaagcgcgaaaagcctggaccgctggaaagcccggctgcttgagggcggaagtact
gcgttgacgtacgccttagtaagggcggaagtgagttttccagcggaagtggctcctgta
aggcagcaaggtagcgtggccggcgtccgagcaggggttgtgtccctgctgggctgccgt
tccagctggactgccgccatggaactcagcgccgaatacctccgcgagaagctgcagcgg
gacctggaggcggagcatgtggaggtggaggacacgaccctcaaccgttgcgcctgtagc
ttccgagtcctggtggtgtcggccaagttcgaggggaaaccgctgcttcagagacacagg
ctggtgaacgcgtgcctagcagaagagctcccgcacatccatgcctttgaacagaaaacc
ctgaccccagaccagtgggcacgtgagcgacagaaatga

DBGET integrated database retrieval system