KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101133677Help
Entry
101133677         CDS       T02442                                 

Gene name
PUDP
Definition
(RefSeq) pseudouridine 5'-phosphatase
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ggo01009]
    101133677 (PUDP)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     101133677 (PUDP)
Protein phosphatases and associated proteins [BR:ggo01009]
 HAD phosphatases
  Other HAD phosphatases
   101133677 (PUDP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Hydrolase_6 HAD NiFe_hyd_3_EhaA
Motif
Other DBs
NCBI-GeneID: 101133677
NCBI-ProteinID: XP_004063800
Ensembl: ENSGGOG00000004425
UniProt: G3SH27
Position
X
AA seq 228 aa AA seqDB search
MAAPPQPVTHLIFDMDGLLLDTERLYSVVFQEICDRYDKKYSWDVKSLVMGKKALEAAQI
IIDILQLPMSKEELVEESRTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSGSVSF
DMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNG
VEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPPYE
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcccccgcagcccgtcacccacctcatctttgacatggacggacttcttctg
gatactgaacggctgtattcagtggtgtttcaagaaatatgtgatcgctatgacaagaaa
tacagctgggatgtaaagtccctggttatgggtaagaaggcattagaggcggcacagatt
ataatagacatcttgcagctcccgatgtccaaagaggagctggtggaagaaagccgaacg
aagttaaaggaagtgttccccacggctgcgctcatgccaggggctgagaaactcatcatc
cacctgcggaaacacggcatcccctttgcactggccaccagctcggggtccgtgtcgttc
gatatgaagacaagccgccacaaggagttcttcagcttgttttcccacattgtgctggga
gatgaccccgaagtgcagcatggcaagccagacccggacatcttcctagcttgtgccaag
aggttctctccccctcctgctatggagaagtgccttgtctttgaagatgctcccaatggg
gtggaggcggccctggcagctgggatgcaggtggtcatggttcctgacggaaacttgagc
cgagatctgacgacaaaggccaccctggtgctgaattccctgcaggacttccagcccgag
ctgtttggtttgcccccctatgagtga

DBGET integrated database retrieval system