KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101135382
Entry
101135382         CDS       T02442                                 

Gene name
PAX9
Definition
(RefSeq) paired box protein Pax-9
  KO
K09382  paired box protein 1/9
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ggo03000]
    101135382 (PAX9)
Transcription factors [BR:ggo03000]
 Eukaryotic type
  Helix-turn-helix
   Paired box domain only
    101135382 (PAX9)
SSDB
Motif
Pfam: PAX HTH_23 HTH_32 HTH_29
Other DBs
NCBI-GeneID: 101135382
NCBI-ProteinID: XP_004055141
Ensembl: ENSGGOG00000001528
UniProt: G3QGP5
Position
14
AA seq 341 aa
MEPAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARY
NETGSILPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSV
SSISRILRNKIGNLAQQGHYDSYKQHQPTPQPALPYNHIYSYPSPITAAAAKVPTPPGVP
AIPGSVAMPRTWPSSHSVTDILGIRSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHA
VNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGH
GWQHAGGTSLSPHNCDIPASLAFKGMQAAREGSHSVTASAL
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggagccagccttcggggaggtgaaccagctgggaggagtgttcgtgaacgggaggccg
ctgcccaacgccatccggcttcgcatcgtggaactggcccaactgggcatccgaccctgt
gacatcagccgccagctacgggtctcgcacggctgcgtcagcaagatcctggcgcgatac
aacgagacgggctcgatcttgccaggagccatcgggggcagcaagccccgggtcactacc
cccactgtggtgaaacacatccggacctacaagcagagagaccccggcatcttcgcctgg
gagatccgggaccgcctgctggcggacggcgtgtgcgacaagtacaatgtgccctccgtg
agctccatcagccgcattctgcgcaacaagatcggcaacttggcccagcagggtcattac
gactcatacaagcagcaccagccgacgccgcagccagcgctgccctacaaccacatctac
tcgtaccccagccctatcacggcggcggccgccaaggtgcccacgccacccggggtgcct
gccatccccggttcggtggccatgccgcgcacctggccctcctcgcactccgtcaccgac
atcctgggcatccgctccatcaccgaccaagtgagcgacagctccccctaccacagcccc
aaggtggaggagtggagcagcctgggccgcaacaacttccccgccgccgccccgcacgcg
gtgaacgggttggagaagggagccctggagcaggaagccaagtacggtcaggcaccaaat
ggtctcccagctgtgggcagttttgtgtcagcatccagcatggctccttaccctacccca
gcccaagtgtcgccttacatgacctacagcgctgctccttctggttatgttgctggacat
gggtggcaacatgctgggggcacctcattgtctccccacaactgtgacattccggcatcg
ctggcgttcaagggaatgcaggcagccagagaaggtagtcattctgtcacggcttccgcg
ctctga

DBGET integrated database retrieval system