KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101135476
Entry
101135476         CDS       T02442                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase TM7SF2 isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00100  Steroid biosynthesis
ggo01100  Metabolic pathways
Module
ggo_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    101135476 (TM7SF2)
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     101135476 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 101135476
NCBI-ProteinID: XP_004051531
Ensembl: ENSGGOG00000002708
UniProt: G3QJR8
Position
11
AA seq 418 aa
MAPTQGPRAPLEFGGPLGAAALLLLLPATMFHLLLAARSGPARLLGPPASLPGLEALWSP
RALLLWLAWLGLQAALYLLPARKVAEGQELKDKSRLRYPINGFQALVLTALLVGLGMSAG
LPLGALPEMLLPLAFVATLTAFIFSLFLYMKAQVAPVSALAPGGNSGNPIYDFFLGRELN
PRICFFDFKYFCELRPGLIGWVLINLALLMKEAELRGSPSLAMWLVNGFQLLYVGDALWH
EEAVLTTMDITHDGFGFMLAFGDMAWVPFTYSLQAQFLLHHPQPLGLPMASVICLINAIG
YYIFRGANSQKNTFRKNPSDPRVAGLETISTATGRKLLVSGWWGMVRHPNYLGDLIMALA
WSLPCGVSHLLPYFYLLYFTALLVHREARDERQCLQKYGLAWQEYCRRVPYRIMPYIY
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcccccactcagggcccccgggccccgctggaattcggagggcccctgggcgccgcg
gctctgctactgctgctgcccgccaccatgttccacctgctcctggcggcccgttcgggc
cccgcgcgcctgctgggtccacccgcgtccctgcccgggctggaggcgctgtggagccca
cgggcgctgctgctgtggctcgcctggctcggcctgcaggcggcgctctacctactgccg
gcgcgcaaggtggccgaggggcaggaattgaaggacaagagtcgcctgcgctatcctatt
aacggcttccaggccctggtgctgacagccctgttggtggggctggggatgtcagcgggg
ctgcctctgggggcgctcccggaaatgctcctgcccttggcgtttgtcgccaccctcacc
gctttcatcttcagcctctttctctacatgaaggcgcaggtagccccagtttcggccctg
gcacctggggggaactcaggcaatccgatttacgacttttttctgggacgggagctcaac
cctcgtatctgtttcttcgacttcaaatatttctgtgaactgcgacccggcctcatcggc
tgggtcctcatcaacctggccctgttgatgaaagaggcagagcttcggggcagtccctca
ctggccatgtggctggtcaatggcttccagttactctacgtgggtgatgccctctggcac
gaggaggccgtcctcaccaccatggatatcacacatgacgggtttggcttcatgctggcg
tttggggacatggcctgggtgcccttcacctacagcctgcaggcccagttcctgctgcac
cacccgcagcccctggggttgcccatggcctctgtcatctgcctcatcaatgctattggt
tactacatcttccgtggggcgaattcccagaaaaacactttccgaaagaatccttctgac
cccagagtggctgggcttgagaccatctctacagccacagggcggaaactgctggtgtct
gggtggtggggtatggtccgccatcccaactaccttggagacctcatcatggctctggct
tggtccttgccctgcggggtgtcacatctgctgccctacttctacctcctgtacttcacc
gcgctgctggtgcaccgtgaggcccgggatgagcggcagtgcctgcagaagtacggcctg
gcctggcaggagtactgccggcgtgtgccctaccgcatcatgccctacatctactga

DBGET integrated database retrieval system