KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101135527
Entry
101135527         CDS       T02442                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1 isoform X1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ggo01002]
    101135527 (ERAP1)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     101135527 (ERAP1)
Peptidases and inhibitors [BR:ggo01002]
 Metallo peptidases
  Family M1
   101135527 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF1570
Other DBs
NCBI-GeneID: 101135527
NCBI-ProteinID: XP_030867574
Ensembl: ENSGGOG00000009305
Position
5
AA seq 948 aa
MVFLPLKWSLATMSFLLSSLLALLTVSTPSWCQSTEASPKGSGGTPFPWNKIRLPEYVIP
VHYDLLIHANLTTLTFWGTTKVEITASQPTSTIILHSHHLQIFRATLRKGAGERLSEEPL
QVLEHPAQEQIALLAPEPLLVGLPYTVVIHYAGNLSETFHGFYKSTYRTKEGELRLLAST
QFQPTAARMAFPCFDEPAFKASFSIKIRREPRHLAISNMPLVKSVTVAEGLIEDHFDVTV
KMSTYLVAFIISDFESVSKITKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFGIP
YPLPKQDLAAIPDFQSGAMENWGLTTYRESALLFDAEKSSASSKLGITMTVAHELAHQWF
GNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVGDYFFGKCFDAMEVDALNSSHPVS
TPVENPAQIREMFDDVSYDKGACILNMLREYLSADAFKSGIVQYLQKHSYKNTKNEDLWD
SMASICPTDGVKGMDGFCSRSQHSSSSSHWHQEGLDVKTMMNTWTLQKGFPLITITVRGR
NVHMKQEHYMKGSDGAPDTGYLWHVPLTFITSKSDMVHRFLLKTKTDVLILPEEVEWIKF
NVGMNGYYIVHYEDDGWDSLTGLLKGTHTAVSSNDRASLINNAFQLVSIGKLSIEKALDL
SLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEG
SVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLSLPVDVTLAVFDVGAQSTE
GWDFLYSKYQFSLSSTEKSQIEFALCRTQNKEKLQWLLDESFKGDKIKTQEFPQILTLIG
RNPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTSTWLEEVKGFFSSLKE
NGSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLEHDPEADATG
NT seq 2847 nt   +upstreamnt  +downstreamnt
atggtgtttctgcccctcaaatggtcccttgcaaccatgtcatttctactttcctcactg
ttggctctcttaactgtgtccactccttcatggtgtcagagcactgaagcatctccaaaa
ggtagtggtgggacgccatttccttggaataaaatacgacttcctgagtacgtcatccca
gttcattatgatctcttgatccatgcaaaccttaccacgctgaccttctggggaaccacg
aaagtagaaatcacagccagtcagcccaccagcaccatcatcctgcatagtcaccacctg
cagatatttagggccaccctcaggaagggagctggagagaggctatcagaagaacccctg
caggtcctggaacaccccgctcaggagcaaattgcactgctggctcccgagcccctcctt
gttgggctcccatacacagttgtcattcactatgctggcaatctttcggagactttccac
ggattttacaaaagcacctacagaaccaaggaaggggaactgaggttactagcatcaaca
caatttcaacccactgcagctagaatggcctttccctgctttgatgaacctgccttcaaa
gcaagtttctcaatcaaaattagaagagagccaaggcacctagccatctccaatatgcca
ttggtgaaatctgtgactgttgctgaaggactcatagaagaccattttgatgtcactgtg
aagatgagcacctatctggtggccttcattatttcagattttgagtctgtcagcaagata
accaagagtggagtcaaggtttctgtttatgctgtgccagacaagataaatcaagcagat
tatgcactggatgctgcggtgactcttttagaattttatgaggattatttcggcatacca
tatcccctacccaaacaagatcttgctgctattcccgactttcagtctggtgctatggaa
aactggggactgacaacatatagagaatctgctctgttgtttgatgcagaaaagtcttct
gcatcaagtaagcttggcatcacaatgactgtggcccatgaactggcccaccagtggttt
gggaacctggtcactatggaatggtggaatgatctttggctaaatgaaggatttgccaaa
tttatggagtttgtgtctgtcagtgtgacccatcctgaactgaaagttggagattatttc
tttggcaaatgttttgatgcaatggaggtagatgctttaaattcctcacaccctgtgtct
acacctgtggagaatcctgctcagatccgggagatgtttgatgatgtttcttatgataag
ggagcttgtattctgaatatgctaagggagtatcttagtgctgatgcatttaaaagtggt
attgtacagtatctccagaagcatagctataaaaatacaaaaaacgaggacctgtgggat
agtatggcaagtatttgccctacagatggtgtaaaagggatggatggcttttgctctaga
agtcaacattcatcttcatcctcacattggcatcaggaagggctggatgtgaaaaccatg
atgaacacttggacactgcagaagggttttcccctaataaccatcacagtgagggggagg
aatgtacacatgaagcaagagcactacatgaagggctctgacggcgccccggacactggg
tacctgtggcatgttccattgacattcatcaccagcaaatcagacatggtccatcgattt
ttgctaaaaacaaaaacagatgtgctcatcctcccagaagaggtggaatggatcaaattt
aatgtgggcatgaatggctattacattgtgcattacgaggatgatggatgggactctttg
actggccttttaaaaggaacacacacagcagtcagcagtaatgatcgggcgagtctcatc
aacaatgcatttcagctcgtcagcattgggaagctgtccattgaaaaggccttggattta
tccctgtacttgaaacatgaaactgaaattatgcccgtgtttcaaggtttgaatgagctg
attcctatgtataagttaatggagaaaagagatatgaatgaagtggaaactcaattcaag
gccttcctcatcaggctgctaagggacctcattgataagcagacgtggacagacgagggc
tcagtctcagagcgaatgctgcggagtcaactactactcctcgcctgtgtgcacaactat
cagccctgcgtacagagggcagaaggctatttcagaaagtggaaggaatccaatggaaac
ttgagcctgcctgtggacgtgaccttggcagtgtttgatgtgggggcccagagcacagaa
ggctgggattttctttatagtaaatatcagttttctttgtccagtactgagaaaagccaa
attgaatttgccctctgcagaacccaaaataaggaaaagcttcaatggctactagatgaa
agctttaagggagataaaataaaaactcaggagtttccacaaattcttacactcattggc
aggaacccagtaggatacccattggcctggcaatttctgaggaaaaactggaacaaactt
gtacaaaagtttgaacttggctcatcttccatagcccacatggtaatgggtacaacaaat
caattctccacaagcacatggcttgaagaggtaaaaggattcttcagctctttgaaagaa
aatggttctcagctccgttgtgtccaacagacaattgaaaccattgaagaaaacatcggt
tggatggataagaattttgataaaatcagagtgtggctgcaaagtgaaaagcttgaacat
gatcctgaagctgacgcaacaggatga

DBGET integrated database retrieval system