KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101135640Help
Entry
101135640         CDS       T02442                                 

Definition
(RefSeq) heat shock 70 kDa protein 1-like isoform X2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo03040  Spliceosome
ggo04010  MAPK signaling pathway
ggo04141  Protein processing in endoplasmic reticulum
ggo04144  Endocytosis
ggo04213  Longevity regulating pathway - multiple species
ggo04612  Antigen processing and presentation
ggo04915  Estrogen signaling pathway
ggo05134  Legionellosis
ggo05145  Toxoplasmosis
ggo05162  Measles
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101135640
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101135640
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101135640
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101135640
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101135640
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101135640
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    101135640
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    101135640
  09172 Infectious disease: viral
   05162 Measles
    101135640
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101135640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ggo01009]
    101135640
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ggo03041]
    101135640
   03009 Ribosome biogenesis [BR:ggo03009]
    101135640
   03110 Chaperones and folding catalysts [BR:ggo03110]
    101135640
   04131 Membrane trafficking [BR:ggo04131]
    101135640
   03051 Proteasome [BR:ggo03051]
    101135640
   03029 Mitochondrial biogenesis [BR:ggo03029]
    101135640
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ggo04147]
    101135640
Protein phosphatases and associated proteins [BR:ggo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101135640
Spliceosome [BR:ggo03041]
 Complex B
  Other components
   Prp19 complex
    101135640
 Complex C
   Prp19-CDC5 complex
    101135640
Ribosome biogenesis [BR:ggo03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    101135640
Chaperones and folding catalysts [BR:ggo03110]
 Heat shock proteins
  HSP70 / DNAK
   101135640
Membrane trafficking [BR:ggo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    101135640
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    101135640
Proteasome [BR:ggo03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101135640
Mitochondrial biogenesis [BR:ggo03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    101135640
Exosome [BR:ggo04147]
 Exosomal proteins
  Proteins found in most exosomes
   101135640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3
Motif
Other DBs
NCBI-GeneID: 101135640
NCBI-ProteinID: XP_004043744
Ensembl: ENSGGOG00000027934
UniProt: G3S9G1
Position
6
AA seq 641 aa AA seqDB search
MATAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINEGGKPKVLVSYKGENKAFYPEE
ISSMVLTKMKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKGGQGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLV
SHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSIT
RARFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQRLLQDYFNGRD
LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNS
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTF
DIDANGILNVTAMDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAA
KNALESYAFNMKSVVSDEGLKGKISESDKNKILDKCNELLSWLEANQLAEKDEFDHKRKE
LEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggctactgccaagggaatcgccataggcatcgacctgggcaccacctattcctgtgtg
ggggtgttccagcacggcaaggtggagatcatcgccaatgaccagggcaaccgcaccacc
cccagctacgtggccttcacagacaccgagcggctcattggggatgcggccaagaaccag
gtagccatgaatccccagaacactgtttttgatgccaaacgtctgatcggcaggaaattt
aatgatcctgttgtacaatcagatatgaaactttggccttttcaagtgattaatgaagga
ggcaagcccaaagtccttgtgtcctacaaaggggagaataaagctttctaccctgaggaa
atctcttcgatggtattgactaagatgaaggagactgctgaggcttttttgggccaccct
gtcaccaatgcagtgattactgtgccagcctatttcaatgactctcaacgtcaggctact
aaggatgcaggtgtgattgctggacttaatgtgctaagaatcatcaatgagcccacagct
gctgccattgcctatggtttagataaaggaggtcaaggagaacgacatgtcctgattttt
gatctgggtggaggcacatttgatgtgtcaattctgaccatagatgatgggatttttgag
gtaaaggccactgctggggacactcacctgggtggggaggactttgacaacaggcttgtg
agccacttcgtggaggagttcaagaggaaacacaaaaaggacatcagccagaacaagcga
gccgtgaggcggctgcgcaccgcctgcgagagggccaagaggaccctgtcgtccagcacc
caggccaacctagaaattgattcactttatgaaggcattgacttctacacatccatcacc
agagctcgatttgaagagttgtgtgcagacctgtttaggggtaccctggagcctgtagaa
aaagcgcttcgggatgccaagatggataaggctaaaatccatgacattgttttagtaggg
ggctccacccgcatccccaaggtgcagcggctgcttcaggactacttcaatggacgtgat
ctcaacaagagcatcaaccctgatgaggccgtagcatatggggctgcggtacaagcagcc
atcctgatgggggacaagtctgagaaggtacaggacctgctgctgctggacgtggctccc
ctgtccctggggctggagacagctgggggcgtgatgactgccctgataaagcgcaactcc
accatccccaccaagcagacacagattttcaccacctactctgacaaccaacccggggtg
ctgatccaggtgtatgagggcgagagggccatgacaaaggacaacaacctgctggggcgg
tttgacctgactggaatccctccagcacccaggggagttcctcagatcgaggtgacgttt
gacattgatgccaatggtattctcaatgtcacagccatggacaagagcaccggcaaggtg
aacaagatcaccatcaccaatgacaagggccgcctgagcaaggaggagattgagcgcatg
gttctggatgctgagaaatataaagctgaagatgaggtccagagggagaaaattgctgca
aagaatgccttagaatcctatgcttttaacatgaagagtgttgtgagtgatgaaggtttg
aagggcaagattagtgagtctgataaaaataaaatattggataaatgcaacgagctcctt
tcgtggctggaggccaatcaactggcagagaaagatgagtttgatcataagagaaaggaa
ttggagcagatgtgtaaccccatcatcacaaaactctaccaaggaggatgcactgggcct
gcctgtggaacagggtatgtgcctggaaggcctgccacaggccccacaattgaagaagta
gattaa

DBGET integrated database retrieval system