KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101136204
Entry
101136204         CDS       T02442                                 
Symbol
EVX2
Name
(RefSeq) homeobox even-skipped homolog protein 2
  KO
K09320  homeobox even-skipped homolog protein
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ggo03000]
    101136204 (EVX2)
Transcription factors [BR:ggo03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: HOXL
    101136204 (EVX2)
SSDB
Motif
Pfam: Homeodomain MRB1590_C
Other DBs
NCBI-GeneID: 101136204
NCBI-ProteinID: XP_004032880
Ensembl: ENSGGOG00000001335
UniProt: G3S455
Position
11:complement(join(78547249..78547995,78549331..78549602,78550503..78550929))
AA seq 481 aa
MMERIRKEMILMERGLHSPTAGKRFSNLSDSAGNAVLEALENSQHPARLSPRLPSAPLHS
ALGELPAKGKFEIDTLFNLQHTGSESTVSSEISSAAESRKKPGHYSEAAAEADMSSDVEV
GCSALRSPGGLGAAQLKENNGKGYAESGSAAGTTTSASGSGLGSLHGGSGGSGGSAALGG
SGSGADQVRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRR
MKDKRQRLAMSWPHPADPSFYTYMMTHAAATGSLPYPFHSHVPLHYYPHVGVTAAAAAAA
ASGAAAAASSPFATSIRPLDTFRALSHPYSRPELLCSFRHPGLYQAPAAAAGLNSAASAA
AAAAAAAAAASSAAAAGAPPSGGSAPCSCLSCHSSQSAAAAAAAAAAALGSRGGGAGGGG
GGGGGGGGGGGGGAGAGGGSDFGCSAAAPRSESGFLPYSAAVLSKTAVSPPDQRDEAPLT
R
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgatggaaagaataagaaaagagatgattctgatggagagagggctgcacagccctacg
gcgggcaagagattctccaatttgtccgactcggctggcaatgctgtgctcgaggccctg
gaaaattcgcagcacccggctcgcctaagcccgcgcctgccgtctgcccccctgcacagc
gctctgggagaactccccgccaagggcaaattcgaaatagacactttgttcaacctgcag
cacacgggcagcgaaagcaccgtctcctccgaaatctcctccgccgccgagagccgcaag
aagccgggccattattcagaggcggccgctgaggccgacatgagcagcgacgtggaggtg
ggctgctccgcgcttcgctcccccgggggcctcggcgccgctcagcttaaggaaaacaat
ggcaaagggtacgcagagagcggctcggctgccggcaccacgacgtcggcgtcgggctca
ggcctcggaagcctgcatggaggcagcggaggcagcggcgggagcgcggcgctgggtggc
tccggctctggcgcggatcaagtgcggcgctaccgtacggcgttcacccgcgagcagatc
gcgcgcctggagaaggagttctaccgggagaactatgtgtcgcggccccgccggtgcgag
ctggccgcggcactcaacctgcccgaaaccaccatcaaggtgtggttccagaaccggcgc
atgaaggacaagcggcagcgcctggccatgtcctggccgcacccagcggaccccagcttc
tacacctacatgatgacgcacgcggccgccaccggaagcctgccctaccccttccactcg
cacgtgccgctgcactactacccgcacgtgggcgtcacggcggcggcggccgcggctgca
gcctcaggcgcggcggccgcggcttcgtcgcccttcgctacttccatccggccactggac
accttccgcgccctctcgcacccctactctcggccggagctgctgtgtagcttccgccac
cctggtctctaccaggctcccgcggccgccgcggggctcaacagcgcggcctctgccgcg
gcagccgcggcagccgcagcggctgcggcctcctcggcggcggcggccggcgcgcccccc
agcggcggctctgcaccctgctcgtgcctcagttgccacagcagtcagtcggcggcggca
gccgcggcagcagctgccgcagccctgggttcccggggtggcggtgctggcggtggtggt
ggtggtggtggtggcggcggcggcggcggcggcgggggcgcaggggccgggggaggctcg
gacttcggctgcagcgcggcggcgccgcgttccgagagcggcttcctgccctactcggcc
gcggtgcttagtaagacggccgtgagcccgccggaccagagggacgaggctccgctcacc
agataa

DBGET integrated database retrieval system