KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101136993
Entry
101136993         CDS       T02442                                 

Gene name
TRERF1
Definition
(RefSeq) transcriptional-regulating factor 1 isoform X2
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
SSDB
Motif
Pfam: zf-C2H2_6 ELM2 zf-C2H2_4 Myb_DNA-binding zf-C2H2_2 zf-C2H2 Myb_DNA-bind_7 zf-C2HE
Other DBs
NCBI-GeneID: 101136993
NCBI-ProteinID: XP_018885606
Ensembl: ENSGGOG00000012813
Position
6
AA seq 1211 aa
MGDQQLYKTNHVAHGSENLFYQQPPLGVHSGLNHNYGNAVTGGGMDAPQASPISPHFPQD
TRDGLGLPVGSKNLGQMDTSRQGGWGSHAGPGNHVQLRGNLANSNMMWGAPAQAEPTDGY
QYTYSQASEIRTQKLTSGVLHKLDSFTQVFANQNLRIQVNNMAQVLHTQSAVMDGAPDSA
LRQLLSQKPMEPPAPAIPSRYQQVPQQPHPGFTGGLSKPALQVGQHPTQGHLYYDYQQPL
AQVPVQGGQPLQAPQMLSQHMQQMQQHQYYPPQQQQQAGQQRISMQEIQTQPQQIRPSQP
QPQPPPQQQPQQLQLQQRQGSMQIPQYYQPQPMMQHLQEQQQQQMHLQPPSYHRDPHQYT
PEQAHTVQLIPLGSMSQYYYQEPQQPYSHPLYQQSHLSQHQQREDSQLKTYSSDRQAQAM
LSSHGDLGPPDAGMGDPASSDLTRVSSTLPHRPLLSPSGIHLNNMGPQHQQLSPSAMWPQ
MHLPDGRAQPGSPESSGQPKGAFGEQFDAKNKLTCSICLKEFKNLPALNGHMRSHGGMRA
SPNLKQEEGEKVLPPQPQPPLPPPPPPPPQLPPEAESLTPMVMPVSVPVKLLPPKPSSQG
FTNSTVAAPSARDKPASSMSDDEMPVLEIPRKHQPSVPKAEEPLKTVQEKKKFRHRPEPL
FIPPPPSYNPNPAASYSGATLYQSQLRSPRVLGDHLLLDPTHELPPYTPPPMLSPVRQGS
GLFSNVLISGHGPGAHPQLPLTPLTPTPRVLLCRSNSIDGSNVTVTPGPGEQTVDVEPRI
NIGLRFQAEIPELQDISALAQDTHKATLVWKPWPELENHDLQQRVENLLNLCCSSALPGG
GTNSEFALHSLFEAKGDVMVALEMLLLRKPVRLKCHPLANYHYAGSDKWTSLERKLFNKA
LATYSKDFIFVQKMVKSKTVAQCVEYYYTWKKIMRLGRKHRTRLAEIIDDCVTSEEEEEL
EEEEEEDPEEDRKSTKEEESEVPKSPEPPPVPVLAPTEGPPLQALGQPSGSFICEMPNCG
ADCRCHVTPFLPQVFSSRQALNGHARIHGGTNQVTKARGAVPSGKQKPGGTQSGYCSVKS
SPSHSTTSGETDPTTIFPCKECGKVFFKIKSRNAHMKTHRQQEEQQRQKAQKAAFAAEMA
ATIERTTGPVGAPGLLPLDQLSLIKPIKDVDILDDDVVQQLGGVMEEAEVVDTDLLLDDQ
DSVLLQGDAEL
NT seq 3636 nt   +upstreamnt  +downstreamnt
atgggtgaccagcaactgtacaagaccaaccatgtggcccatggtagtgagaaccttttc
taccaacagccaccacttggcgtccacagcgggctgaaccacaactatgggaatgcagta
accgggggcggaatggatgcccctcaggcctcgccaatctccccccacttccctcaagat
acacgggatggtctgggcttgcctgttggctccaaaaaccttggccaaatggatacctcg
aggcagggagggtggggaagtcatgcagggcctggaaaccatgtccagctacgtggaaac
ctggccaactcaaacatgatgtggggggcaccagcccaggctgagcccactgatggctac
caatacacctactcccaggccagcgagatccggacccagaagcttaccagcggtgtctta
cacaagctggactctttcacccaggtgtttgccaaccaaaacctgcgaattcaggtcaac
aatatggcccaggtgctgcacactcagtcagcagtgatggatggagcccctgacagtgct
ctccgccagctgctgtctcagaagcccatggagcccccagcaccggctatcccttcccgc
taccagcaggtgccccagcagcctcaccctggtttcactggtgggctgtccaaaccagct
cttcaggtcgggcagcaccctacccaagggcacctgtattatgactaccagcagcctctg
gctcaggtgccagtgcagggaggacagccactgcaagccccacagatgctgtcacagcac
atgcaacagatgcagcagcaccagtattacccaccgcagcaacagcagcaagccgggcaa
cagcgtatctccatgcaagaaatacagacgcagccgcaacaaatacgcccatcacagccg
cagccgcagccaccgccacagcagcagccgcagcagctacagctgcagcagcggcagggt
tcaatgcagatacctcagtattatcagccccaacccatgatgcagcacttgcaagagcag
cagcagcaacagatgcacctgcagcccccttcttatcacagggaccctcaccagtatacc
ccagagcaggcacacactgtccagctgattcccctgggctccatgtcccagtactactac
caggagccccagcagccctacagccaccccctctaccagcagagccacctgtcccagcac
cagcagcgtgaggacagtcagctgaagacctactctagtgacagacaggcccaggccatg
ctgagctcccatggggacctggggcctcctgacgcaggaatgggagacccagcgagctca
gatctgacccgggtcagcagcaccctcccccatcgccccctcctatcccccagtgggatc
cacctcaacaacatggggcctcagcatcagcagctgtctcccagtgccatgtggccccag
atgcacctacctgatgggagagcccagccagggtcccctgagtcaagtggccaacccaaa
ggagcgtttggggagcagtttgatgccaagaacaagctgacatgctccatctgcctgaag
gagttcaagaacctgcctgccctgaacggccacatgcggtcccacgggggaatgagggcc
tcccccaacctcaaacaggaggaaggagagaaggtcctgccgcctcagccccagccacca
ctgccgcctccgcctccgccgccaccacagctccctcccgaggcagaaagcctcacgcct
atggtcatgcccgtgtctgtccctgtcaagcttctcccgcccaagcccagctctcagggg
ttcaccaacagcaccgttgccgccccctccgccagagacaagccagccagctcgatgtcg
gacgacgagatgcctgtgctcgaaatccccaggaagcatcagccgagtgtgcccaaagcc
gaggagcccctcaagaccgtgcaggagaagaaaaagttccggcaccggccggaacctctc
ttcatcccaccgccgccctcctacaacccgaaccccgccgcctcctactcgggcgccacc
ctgtaccagagccagctgcgctccccacgcgtcctcggggaccacctgctcctggacccc
acccacgagctgcccccttacacgcccccacccatgctgagcccggtgcgccagggctcg
gggctcttcagcaatgtcctcatctccggccacggccctggcgcccacccgcagctgccc
ctgacgcccctgacgcccacaccacgggtgctgctgtgtcgctccaacagcatcgatggc
agcaacgtgacggtcaccccagggcctggagagcagactgtagatgttgaaccacgcatc
aacattggcttgagattccaagcagaaatccctgaactccaagatatctctgccctggcc
caggacacacacaaggccacgctggtatggaagccctggccagaactagaaaaccatgac
ctccagcaaagagtggagaatcttctgaatttgtgctgttccagtgcattgccaggtgga
gggaccaattctgaatttgctttgcactctctgtttgaggccaaaggtgatgtgatggtt
gctctggaaatgctgctactgcggaagcctgtcaggttaaaatgtcatcctttagcaaat
taccactatgccggttcggacaagtggacctccctagaaagaaaactgtttaacaaagca
ctagccacttacagcaaagactttatttttgtacagaagatggtgaagtccaagacggtg
gctcagtgcgtggagtactactacacgtggaaaaagatcatgcggctggggcggaaacac
cggacacgcctggcagaaatcatcgacgattgtgtgacaagtgaagaagaagaagagtta
gaggaggaggaggaggaggacccggaagaagataggaaatccacaaaagaagaagagagt
gaggtgccgaagtccccggagccaccacccgtccccgtcctggctcccacggaggggccg
cccctgcaggccctgggccagccctcaggctccttcatctgtgaaatgcccaactgtggg
gctgactgtagatgtcatgtcactccctttcttccccaggtgttcagctcccgacaggca
ctgaatggccatgcccgcatccacgggggcaccaaccaggtgaccaaggcccgaggtgcc
gtcccctctgggaagcagaagcctggtggcacccagagtgggtactgttcggtgaagagc
tcaccctctcacagcaccaccagcggcgagacagaccccaccaccatcttcccctgcaag
gagtgtggcaaagtcttcttcaagatcaaaagccgaaatgcacacatgaaaactcacagg
cagcaggaggaacaacagaggcaaaaggctcagaaggcggcttttgcagctgagatggca
gccacgattgagaggactacggggcccgtgggggcgccggggctgctgcccctggaccag
ctgagtctgatcaaacccatcaaggacgtggacatcctcgacgacgacgtcgtccagcag
ttgggaggtgtcatggaagaggctgaagttgtggacaccgatcttctcttggatgatcaa
gattcagtcttgcttcagggtgacgcagaactataa

DBGET integrated database retrieval system