KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101137101
Entry
101137101         CDS       T02442                                 

Gene name
AHRR
Definition
(RefSeq) LOW QUALITY PROTEIN: aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ggo03000]
    101137101 (AHRR)
Transcription factors [BR:ggo03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101137101 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_4 PAS_3 PAS_9
Other DBs
NCBI-GeneID: 101137101
NCBI-ProteinID: XP_018868808
Ensembl: ENSGGOG00000013694
Position
17
AA seq 714 aa
MIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQVVQEQSSRQPAAGAPSPGDSRPLAGSAVLEGRLLLESLN
GFALVVSAEGTIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQV
VFGQPPPLETGDDAILGRLLRAQEWGAGTPTEYSAFLTRCFICRVRCLLDSTSGFLAXGL
QAWQLRLCCPEPLMTMQFQGKLKFLFGQKKKAPSGAMLPPQLSLFCIAAPVLLPSAAEMK
MRSALLRAKPRADTAATMDAKVKATTSLCESELHGKPNYSAGRSSRESGVLVLREQTDIG
RWAQVPARAPCLCLRGGPDLVLDPKGGSGDREEEHRMLSRASGVTGQRETPGPTKPLPWT
AGKHSEDGARPRLQPSKNDPPSLRPTPRGSCLPYPCVQGTFRNSPISHPPSPSPSAYSSR
TSRPVRDVDEDQVHPPLCHFPQGSLQHQLPQPGARRFAARGYPMEDVKLQGVPMPPGDLC
GPTLLLDVSVKMEKDSGCEDAADGCVPSQVWLGASDRSHPAAFPTRMHLKTEPDSRQQVY
ISHLGHGVRGAQPHGRATAGRSRELTPFHPAHCACLEPTHGLPQSEPPHQLCARGRGERS
CTCRAAEAAPVVKREPLDSPQWATHSQGVVPGMFPKSALATLVPPQASGCTFLP
NT seq 2145 nt   +upstreamnt  +downstreamnt
atgatcccgccgggggagtgcacgtacgcgggccggaagcggaggaggcccctgcagaaa
cagaggcccgccgtgggggcagagaagtccaacccctccaagcgacaccgggaccgcctc
aacgccgagttggaccacctggccagcctgctgccgttcccgcctgacatcatctccaag
ctggacaagctttctgtcctgcgcctcagtgtcagttacctccgggtgaagagcttcttc
caagtcgtgcaggagcagagctcacggcagcctgcggccggcgccccctcgcctggagac
agccgtcctcttgcagggtctgctgtgctggagggaaggctgctgttggagtctcttaat
ggctttgctctggtcgtgagtgcagaagggacgatattttatgcgtcagcaacgatcgtg
gactatctgggcttccatcagacggatgtaatgcaccagaacatttacgactacatccac
gtggacgaccgccaggacttctgccggcagctccactgggccatggaccctccccaggtg
gtgtttgggcagcccccgcccttggagacaggagatgatgctatcctggggaggctgctc
agggcccaggagtggggcgcaggcacgcccaccgagtactcggccttcctgacccgctgc
ttcatctgccgtgtgcgctgcctgctggacagcacctcgggcttcctggcctgagggtta
caggcttggcagctgcggctctgctgtcccgagccactcatgacgatgcagtttcaagga
aaactaaaattcctgtttggacagaagaagaaggcgccgtcaggagccatgctcccgccg
cagctgtcgctgttctgcattgcggcacccgttctcctcccctccgcagcggagatgaaa
atgaggagcgcgctcctgagggcaaaacccagggcagacaccgcagccaccatggatgca
aaagtaaaagccaccaccagtctgtgcgaatcggaactgcatggaaaacccaattactca
gcaggaaggagcagcagagagagcggcgttttggttctcagggaacagactgacattggc
cgatgggcacaggttcccgccagggccccatgcctgtgcctccggggcggccctgacctt
gtccttgaccccaaagggggctcaggggacagggaggaggagcacaggatgctgagcagg
gcctctggagtgacagggcagagagagactccaggacccacaaagcccctgccctggaca
gcgggaaagcacagtgaggatggtgccaggccgaggctgcagcccagcaagaatgaccca
ccctccctgcgccccacgccccgcggctcctgcctgccctacccgtgtgtccagggcact
ttcaggaactcgcccatctctcacccgccgagcccgtcccccagtgcctactccagccgg
accagcagacccgtgcgggatgtcgatgaggaccaggtgcaccctcccctctgccacttt
ccccaggggagcctgcagcaccagctccctcagcctggagctcggcgttttgccgcgagg
ggctatcccatggaggacgtgaagctgcaaggtgtaccgatgcctccgggggacctgtgt
ggtccgacactgctgctagatgtgtccgtcaagatggagaaggactctgggtgtgaggat
gctgcagacggctgtgtgcccagccaggtgtggctgggggccagtgacaggagccaccca
gccgccttccctaccaggatgcacctgaaaacagagccagactctcggcaacaggtgtac
atctcgcacctggggcacggcgtgcggggggctcagccccatgggagggccactgctggg
cgcagcagggagctgacccctttccaccctgcacactgtgcctgcctggagcccacacac
ggccttccccagtcggagcctccccaccagctctgtgcgcggggccgaggtgaacggtcc
tgcacctgcagagctgctgaggccgcccctgtggtcaagcgggagcccttggactcgccc
cagtgggctactcacagccagggagtggtgcccgggatgtttcccaaaagtgccttggcc
acgctggtcccgccccaagcttcggggtgcacattcctgccatag

DBGET integrated database retrieval system