KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101137174
Entry
101137174         CDS       T02442                                 

Gene name
PAX8
Definition
(RefSeq) paired box protein Pax-8 isoform X2
  KO
K09293  paired box protein 8
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04918  Thyroid hormone synthesis
ggo05200  Pathways in cancer
ggo05202  Transcriptional misregulation in cancer
ggo05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    101137174 (PAX8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101137174 (PAX8)
   05202 Transcriptional misregulation in cancer
    101137174 (PAX8)
  09162 Cancer: specific types
   05216 Thyroid cancer
    101137174 (PAX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ggo03000]
    101137174 (PAX8)
Transcription factors [BR:ggo03000]
 Eukaryotic type
  Helix-turn-helix
   Paired box domain only
    101137174 (PAX8)
SSDB
Motif
Pfam: PAX Pax2_C HTH_23 HTH_32 HTH_Tnp_IS1 HTH_38
Other DBs
NCBI-GeneID: 101137174
NCBI-ProteinID: XP_004031692
Ensembl: ENSGGOG00000004587
Position
2A
AA seq 456 aa
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSK
ILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDND
TVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY
SINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPF
ERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVAD
PHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPAGASVPPFNAFPHAASVYGQ
FTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYS
EAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgcctcacaactccatcagatctggccatggagggctgaaccagctgggaggggccttt
gtgaatggtagacccctgccggaagtggtccgccagcgcattgtagacctggcccaccag
ggtgtaaggccctgcgacatttctcgccagctccgcgtcagccatggctgcgtcagcaag
atccttggcaggtactacgagactggcagcatccggcctggagtgatagggggctccaag
cccaaggtggccacccccaaggtggtggagaagattggggactacaaacgccagaaccct
accatgtttgcctgggagatccgagaccggctcctggctgagggcgtctgtgacaatgac
actgtgcccagtgtcagctccattaatagaatcatccggaccaaagtgcagcaaccattc
aacctccctatggacagctgcgtggccaccaagtccctgagtcccgggcacacgctgatc
cccagctcagctgtaactcccccggagtcaccccagtcggattccctgggctccacctac
tccatcaatgggctcctgggcatcgctcagcctggcagcgacaagaggaaaatggatgac
agtgatcaggatagctgccggctaagcattgactcacagagcagcagcagcggaccccga
aagcaccttcgcacggatgccttcagccagcaccacctcgagccgctcgagtgcccattt
gagcggcagcactacccggaggcctatgcctcccccagccacaccaaaggcgagcagggc
ctctacccgctgcccttgctcaacagcaccctggacgacgggaaggccaccctgacccct
tccaacacgccactggggcgcaacctctcgactcaccagacctaccccgtggtggcagat
cctcattcacccttcgccataaagcaggaaacccccgaggtgtccagttctagctccacc
ccttcctctttatctagctccgcctttttggatctgcagcaagtcggctccggggtccca
gccggtgcctcggtcccgcccttcaatgcctttccccatgctgcctccgtgtacgggcag
ttcacgggccaggccctcctctcagggcgagagatggtggggcccacgctgcccggatac
ccaccccacatccccaccagcggacagggcagctatgcctcctctgccatcgcaggcatg
gtggcaggaagtgaatactctggcaatgcctatggccacaccccctactcctcctacagc
gaggcctggcgcttccccaactccagcttgctgagttccccatattattacagttccaca
tcaaggccgagtgcaccgcccaccactgccacggcctttgaccatctgtag

DBGET integrated database retrieval system