KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101137720Help
Entry
101137720         CDS       T02442                                 

Gene name
CMTR1
Definition
(RefSeq) cap methyltransferase 1
  KO
K14589  cap1 methyltransferase [EC:2.1.1.57]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ggo03019]
    101137720 (CMTR1)
Enzymes [BR:ggo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.57  methyltransferase cap1
     101137720 (CMTR1)
Messenger RNA biogenesis [BR:ggo03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Capping factors
     101137720 (CMTR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FtsJ G-patch G-patch_2 mRNA_cap_enzyme WW DNA_ligase_A_M
Motif
Other DBs
NCBI-GeneID: 101137720
NCBI-ProteinID: XP_004043993
Ensembl: ENSGGOG00000005640
UniProt: G3QSA2
Position
6
AA seq 835 aa AA seqDB search
MKRRTDPECTAPIKKQKKRVAELALSLSSTSDDEPPSSVSHGAKASTTSLSGSDSETEGK
QHSSDSFDDAFKADSLVEGTSSRYSMYNSVSQKLMAKMGFREGEGLGKYSQGRKDIVEAS
SQKGRRGLGLTLRGFDQELNVDWRDEPEPSACEQVSWFPECTTEIPDTQEMSDWMVVGKR
KMIIEDETEFCGEELLHSVLQCKSVFDVLDGEEMRRARTRANPYEMIRGVFFLNRAAMKM
ANMDFVFDRMFTNPRDSYGKPLVKDREAELLYFADVCAGPGGFSEYVLWRKKWHAKGFGM
TLKGPNDFKLEDFYSASSELFEPYYGEGGIDGDGDITRPENISAFRNFVLDNTDRKGVHF
LMADGGFSVEGQENLQEILSKQLLLCQFLMALSIVRTGGHFICKTFDLFTPFSVGLVYLL
YCCFERVCLFKPITSRPANSERYVVCKGLKVGIDDVRDYLFAVNIKLNQLRNTDSDVNLV
VPLEVIKGDHEFTDYMIRSNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWG
IPDQARVAPSSSDPKSKFFELIQGTEIDIFSYKPTLLTSKTLEKIRPVFDYRCMVSGSEQ
KFLIGLGKSQIYTWDGRQSDRWIKLDLKTELPRDTLLSVEIVHELKGEGKAQRKISAIHI
LDVLVLNGTDVREQHFNQRIQLAEKFVKAVSKPSRPDMNPIRVKEVYRLEEMEKIFVRLE
MKIIKGSSGTPKLSYTGRDDRHFVPMGLYIVRTVNEPWTMGFSKSFKKKFFYNKKTKDST
FDLPADSIAPFHICYYGRLFWEWGDGIRVHDSQKPQDQDKLSKEDVLSFIQMHRA
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggagaactgacccagaatgcactgcccccatcaagaaacagaaaaaaagagtt
gcagagcttgccctgagcctcagctccacgtccgatgatgaacctccctcctctgtcagt
catggagcaaaagcatctactacaagccttagtgggtctgatagtgagaccgaggggaaa
caacacagctctgactcttttgacgatgcattcaaagcagactctcttgtggaaggaact
tcttctcgctattccatgtataatagtgtctcccagaagcttatggccaagatgggcttc
agggaaggtgaaggattgggtaaatacagccagggtcggaaggacatcgttgaggcttcc
agtcagaaaggtcgaagaggcttgggtctgacactccggggctttgaccaggagctgaac
gtggactggcgagatgagccagagcccagtgcttgtgagcaggtgtcatggtttccagaa
tgtaccactgaaattcctgacactcaggaaatgagcgattggatggtggtgggaaagaga
aagatgattattgaagatgaaacagagttttgtggggaagagctgcttcacagtgtgttg
cagtgtaagagcgtgtttgatgtcttggatggggaagagatgcggcgagctcggactcgg
gccaatccctatgagatgatccgaggagtcttctttctaaacagggcagcaatgaagatg
gctaacatggattttgtatttgatcgcatgttcacaaatccgcgggactcttatgggaag
ccactggtgaaggaccgggaagctgagcttctgtactttgctgatgtctgcgcaggccca
ggtggcttctcagagtatgtgctgtggaggaagaagtggcatgcaaagggctttggaatg
actttgaagggccctaatgacttcaagctggaggacttctactctgcttccagtgaactc
ttcgaaccctactatggtgagggtgggattgatggagatggagatatcacccgcccagag
aacatctctgcttttcggaattttgtcctggataacacagatcgcaagggtgtccatttt
ctgatggctgatgggggtttctcggtggaggggcaggagaacctgcaggagatcctcagc
aagcagctgcttctgtgtcagttcctcatggcgctgtccattgtccggacaggaggccac
ttcatctgtaaaacctttgacctgttcacaccgtttagtgtggggcttgtctacctgctg
tactgctgctttgaacgagtttgtctcttcaagcctattaccagccgtcctgccaactca
gagaggtatgtggtgtgcaagggcctgaaggtgggcatagatgatgttcgggattacctc
ttcgcagtgaatattaaactcaatcagctgcggaacacggattccgacgtcaacttggtg
gtccccctggaggtgatcaagggagaccatgaatttactgactacatgatacggtccaat
gagagccactgtagtctgcagatcaaagctctggcgaaaattcatgcctttgttcaagac
acgacactgagtgagcctcgacaggcagagatacggaaggagtgcctccgactctggggg
atcccagaccaggctcgtgtggctccttcttcctccgaccctaaatcgaagttctttgag
ctaatccagggcactgagattgacatcttcagctacaagcccacactgctcacctctaaa
accctggagaagatccgccctgtgtttgactaccgctgtatggtatctggcagtgagcag
aagttcctcatcggcctggggaaatcccagatctacacgtgggatggccgccagtcagac
cgctggatcaagctagacctgaagacagagctgccccgggacactctgctatctgtggaa
attgtgcatgagctgaaaggggaggggaaggcccagaggaagatcagtgccatccacatc
ctcgatgtccttgtgctgaatggcaccgacgttcgggagcagcactttaaccagcgaatt
cagcttgccgagaaatttgtgaaagccgtttccaagcccagtcggcccgacatgaatccc
atcagggtgaaggaggtgtacagactggaagagatggagaagatttttgtcaggttggag
atgaagatcatcaagggctccagtggcaccccaaagctcagctacacagggcgtgatgac
cggcactttgtacccatgggcctctacatcgtcaggacagtgaatgagccctggactatg
ggattcagcaaaagcttcaagaagaagttcttctacaacaagaaaaccaaggactctact
tttgacctccctgcagactccattgccccatttcacatttgctactatggccggctcttc
tgggagtggggggatggcattcgtgtgcatgactcccagaagccccaggaccaggacaag
ctgtccaaggaggacgtcctctccttcatccagatgcacagggcctaa

DBGET integrated database retrieval system