KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101137902Help
Entry
101137902         CDS       T02442                                 

Gene name
MAP4K4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4 isoform X1
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101137902 (MAP4K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101137902 (MAP4K4)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101137902 (MAP4K4)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: STE group
  STE20 family
   101137902 (MAP4K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 101137902
NCBI-ProteinID: XP_030863718
Ensembl: ENSGGOG00000010831
Position
2A
AA seq 1393 aa AA seqDB search
MANDSPAKSLVDIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRI
QLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRDFLRLQ
QENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREAR
RQQEREQRRREQEEKRRLEELERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEEQRHLE
VLQQQLLQEQAMLLECRWREMEEHRQAERLQRQLQQEQAYLLSLQHDHRRPHPQHSQQPP
PPQQERSKPSFHAPEPKAHYEPADRAREVEDRFRKTNHSSPEAQSKQTGRVLEPPVPSRS
ESFSNGNSESVHPALQRPAEPQVQWSHLASLKNNVSPVSRSHSFSDPSPPKFAHHHLRSQ
DPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPVLSRRDSPLQ
GSGQQNSQAGQRNSTSSIEPRLLWERVEKLVPRPGSGSSSGSSNSGSQPGSHPGSQSGSG
ERFRVRSSSKSEGSPSQRLENAVKKPEDKKEVFRPLKPAGEVDLTALAKELRAVEDVRPP
HKVTDYSSSSEESGTTDEEDDDVEQEGADESTSGPEDTRAASSLNLSNGETESVKTMIVH
DDVESEPAMTPSKEGTLIVRQSTVDQKRASHHESNGFAGRIHLLPDLLQQSHSSSTSSTS
SSPSSSQPTPTMSPQTPQDKLTANETQSASSTLQKHKSSSSFTPFIDPRLLQISPSSGTT
VTSVVGFSCDGMRPEAIRQDPTRKGSVVNVNPTNTRPQSDTPEIRKYKKRFNSEILCAAL
WGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLVTISGKKDKLRVYYL
SWLRNKILHNDPEVEKKQGWTTVGDLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKP
YHKFMAFKSFGELVHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHVR
KNPHSMIQCSIKPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVA
YIRSNQTMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQV
YFMTLGRTSLLSW
NT seq 4182 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgactcccctgcaaaaagtctggtggacatcgacctctcctccctgcgggat
cctgctgggatttttgagctggtggaagtggttggaaatggcacctatggacaagtctat
aagggtcgacatgttaaaacgggtcagttggcagccatcaaagttatggatgtcactgag
gatgaagaggaagaaatcaaactggagataaatatgctaaagaaatactctcatcacaga
aacattgcaacatattatggtgctttcatcaaaaagagccctccaggacatgatgaccaa
ctctggcttgttatggagttctgtggggctgggtccattacagaccttgtgaagaacacc
aaagggaacacactcaaagaagactggatcgcttacatctccagagaaatcctgagggga
ctggcacatcttcacattcatcatgtgattcaccgggatatcaagggccagaatgtgttg
ctgactgagaatgcagaggtgaaacttgttgactttggtgtgagtgctcagctggacagg
actgtggggcggagaaatacgttcataggcactccctactggatggctcctgaggtcatc
gcctgtgatgagaacccagatgccacctatgattacagaagtgatctttggtcttgtggc
attacagccattgagatggcagaaggtgctccccctctctgtgacatgcatccaatgaga
gcactgtttctcattcccagaaaccctcctccccggctgaagtcaaaaaaatggtcgaag
aaattttttagttttatagaagggtgcctggtgaagaattacatgcagcggccctctaca
gagcagcttttgaaacatccttttataagggatcagccaaatgaaaggcaagttagaatc
cagcttaaggatcatatagatcgtaccaggaagaagagaggcgagaaagatgaaactgag
tatgagtacagtgggagtgaggaagaagaggaggaagtgcctgaacaggaaggagagcca
agttccattgtgaacgtgcctggtgagtctactcttcgtcgagatttcctgagactgcag
caggagaacaaggaacgttccgaggctcttcggagacaacagttactacaggagcaacag
ctccgggagcaggaagaatataaaaggcaactgctggcagagagacagaagcggattgag
cagcagaaagaacagaggcgacggctagaagagcaacaaaggagagagcgtgaagctaga
aggcagcaggaacgtgaacagcgaaggagagaacaagaagaaaagaggcgtctagaggag
ttggagagaaggcgcaaagaagaagaggagaggagacgggcagaagaagaaaagaggaga
gttgaaagagaacaggagtatatcaggcgacagctagaagaggagcagcggcacttggaa
gtccttcagcagcagctgctccaggagcaggccatgttactggagtgccgatggcgggag
atggaggagcaccggcaggcagagaggctccagaggcagttgcaacaagaacaagcatat
ctcctgtctctacagcatgaccataggaggccgcacccgcagcactcgcagcagccgcca
ccaccgcagcaggaaaggagcaagccaagcttccatgctcccgagcccaaagcccactac
gagcctgctgaccgagcgcgagaggtggaagatagatttaggaaaactaaccacagctcc
cctgaagcccagtctaagcagacaggcagagtattggagccaccagtgccttcccgatca
gagtctttttccaatggcaactccgagtctgtgcatcccgccctgcagagaccagcggag
ccacaggtacagtggtcccacctggcatctctcaagaacaatgtttcccctgtctcgcga
tcccattccttcagtgacccttctcctcccaaatttgcacaccaccatcttcgttctcag
gacccatgtccaccttcccgcagtgaggtgctcagtcagagctctgactctaagtcagag
gcgcctgaccctacccaaaaggcttggtctagatcagacagtgacgaggtgcctccaagg
gttcctgtgagaacaacatctcgctcccctgttctgtcgcgtcgagattccccactgcag
ggcagtgggcagcagaatagccaggcaggacagagaaactccaccagcagtattgagccc
aggcttctgtgggagagagtggagaagctggtgcccagacctggcagtggcagctcctca
gggtccagcaactcaggatcccagcccgggtctcaccctgggtctcagagtggctccggg
gaacgcttcagagtgagatcatcatccaagtctgaaggctctccatctcagcgcctggaa
aatgcagtgaaaaaacctgaagataaaaaggaagttttcagacccctcaagcctgctggc
gaagtggatctgactgcactggccaaagagcttcgagcagtggaagatgtacggccacct
cacaaagtaacggactactcctcatccagtgaggagtcggggacgacggatgaggaggac
gacgatgtggagcaggaaggggctgacgagtccacctcaggaccagaggacaccagagca
gcgtcatctctgaatttgagcaatggtgaaacggaatctgtgaaaaccatgattgtccat
gatgatgtagaaagtgagccggccatgaccccatccaaggagggcactctaatcgtccgc
cagagtacagttgaccaaaagcgtgccagccatcatgagagcaatggctttgccggtcgc
attcacctcttgccagatctcttacagcaaagccattcctcctccacttcctccacctcc
tcctccccatcctccagccagccgacacccaccatgtccccacagacaccccaggacaag
ctcactgctaatgagactcagtccgctagtagcacactccagaaacacaaatcttcctcc
tcctttacaccttttatagaccccagattactacagatttctccatctagcggaacaaca
gtgacttctgtggtgggattttcctgtgatgggatgagaccagaagccataaggcaagat
cctacccggaaaggctcagtggtcaatgtgaatcctaccaacactaggccacagagtgac
accccggagattcgtaaatacaagaagaggtttaactctgagattctgtgtgctgcctta
tggggagtgaatttgctagtgggtacagagagtggcctgatgctgctggacagaagtggc
caagggaaggtctatcctctgatcaaccgaagacgatttcaacaaatggacgtacttgag
ggcttgaatgtcttggtgacaatatctggcaaaaaggataagttacgtgtctactatttg
tcctggttaagaaataaaatacttcacaatgatccagaagttgagaagaagcagggatgg
acaaccgtaggggatttggaaggatgtgtacattataaagttgtaaaatatgaaagaatc
aaatttctggtgattgctttgaagagttctgtggaagtctatgcgtgggcaccaaagcca
tatcacaaatttatggcctttaagtcatttggagaattggtacataagccattactggtg
gatctcactgttgaggaaggccagaggttgaaagtgatctatggatcctgtgctggattc
catgctgttgatgtggattcaggatcagtctatgacatttatctaccaacacatgtaaga
aagaacccacactctatgatccagtgtagcatcaaaccccatgcaatcatcatcctcccc
aatacagatggaatggagcttctggtgtgctatgaagatgagggggtttatgtaaacaca
tatggaaggatcaccaaggatgtagttctacagtggggagagatgcctacgtcagtagca
tatattcgatccaatcagacaatgggctggggagagaaggccatagagatccgatctgtg
gaaactggtcacttggatggtgtgttcatgcacaaaagggctcaaagactaaaattcttg
tgtgaacgcaatgacaaggtgttctttgcctctgttcggtctggtggcagcagtcaggtt
tatttcatgaccttaggcaggacttctcttctgagctggtag

DBGET integrated database retrieval system