KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101139984Help
Entry
101139984         CDS       T02442                                 

Gene name
PLCD1
Definition
(RefSeq) phospholipase C delta 1
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00562  Inositol phosphate metabolism
ggo01100  Metabolic pathways
ggo04020  Calcium signaling pathway
ggo04070  Phosphatidylinositol signaling system
ggo04919  Thyroid hormone signaling pathway
ggo04933  AGE-RAGE signaling pathway in diabetic complications
Module
ggo_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101139984 (PLCD1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101139984 (PLCD1)
   04070 Phosphatidylinositol signaling system
    101139984 (PLCD1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101139984 (PLCD1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101139984 (PLCD1)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101139984 (PLCD1)
Membrane trafficking [BR:ggo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101139984 (PLCD1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101139984 (PLCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 PH_12 PH EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5 TEP1_N
Motif
Other DBs
NCBI-GeneID: 101139984
NCBI-ProteinID: XP_004033888
Ensembl: ENSGGOG00000003801
UniProt: G3RXS3
Position
3
AA seq 756 aa AA seqDB search
MDSGRDFLTLHGLQDDEDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMR
TPESQLFSIEDIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH
WVLGLHKIIHHSGSMDQRQKLQHWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSY
ARKIFRECDHSQTDSLEDEEIEAFYKMLTQRVEIDRTFAEAAGSGETLSVDQLVTFLQHQ
QREEVAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFSLAHRRVYQDMGQ
PLSHYLVSSSHNTYLLEDQLAGPSSTEAYIRALCKGCRCLELDCWDGPNQEPIIYHGYTF
TSKILFCDVLRAIRDYAFKASPYPVILSLENHCTLEQQRVMARHLHAILGPMLLNRPLDG
VTNSLPSPEQLKGKILLKGKKLGGLLPPGGEGGPEATVVSDEDEAAEMEDEAVRSRVQHK
PKEDKLRLAQELSDMVIYCKSVHFGGFSSPGTPGQAFYEMASFSENRALRLLQESGNGFV
RHNVGHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYQGRFQDNGACG
YVLKPAFLRDPNGTFNPRALAQGPWWARKRLNIRVISGQQLPKVNKNKNSIVDPKVTVEI
HGVSRDVASRQTAVITNNGFNPWWDTEFAFEVVVPDLALVRFLVEDYDASSKNDFIGQST
IPLNSLKQGYRHVHLMSKNGDQHPSATLFVKISLQD
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggactcgggccgggacttcctgaccctgcacggcctacaggatgatgaggatctacag
gcgctgctgaagggcagccagctcctgaaggtgaagtccagctcatggaggagagagcgc
ttctacaagttgcaggaggactgcaagaccatctggcaggagtcccgcaaggtcatgcgg
accccggagtcccagctgttctccatcgaggacattcaggaggtgcgaatggggcaccgc
acggagggtctggagaagttcgcccgtgatgtgcccgaggaccgctgcttctccattgtc
ttcaaggaccagcgcaatacactagacctcatcgccccatcgccagctgatgcccagcac
tgggtgctggggctgcacaagatcatccaccactcaggctccatggaccagcgtcagaag
ctacagcactggattcactcctgcttgcgaaaagctgacaaaaacaaggacaacaagatg
agcttcaaggagctgcagaacttcctgaaggagctcaacatccaggtggacgacagctat
gcccggaagatcttcagggagtgtgaccactcccagacagactccctggaggatgaggag
attgaggccttctacaagatgctgacccagcgggtggagatcgaccgcaccttcgctgag
gccgcgggctcaggggagactctgtcggtggatcagttagtgacgttcctgcagcaccag
cagcgggaggaggtggcagggcctgcgctggccctctccctcattgagcgctacgagccc
agcgagactgccaaggcgcagcggcagatgaccaaggacggcttcctcatgtacttactg
tcggctgacggcagcgccttcagcctagcacaccgccgtgtctaccaggacatgggccag
ccgcttagccactacctggtgtcctcttcacacaacacctacctgctggaggaccagcta
gccgggcccagcagcactgaagcctacatccgggcactgtgcaaaggctgccgatgcctg
gagcttgactgctgggacgggcccaaccaggaaccaatcatctaccacggctatactttc
acttccaagatcctcttctgcgatgtgctcagggccatccgggactatgccttcaaggcg
tccccctaccctgtcatcctatccctggagaaccactgcacactggagcagcagcgcgtg
atggcgcggcacctgcatgccatcctgggccccatgctgttgaaccgaccactggatggg
gtcaccaacagcctgccctcccctgagcaactgaaggggaagatcctgctgaaggggaag
aagctcggggggctcctgccccctggaggggagggtggccctgaggccactgtggtgtct
gacgaagacgaggctgctgagatggaggatgaggcagtgaggagccgtgtgcagcacaag
cccaaggaggacaagctcaggctagcacaggagctctctgacatggtcatttactgcaag
agtgtccactttgggggcttctccagtcctggcacccctggacaggccttctacgagatg
gcgtccttctctgagaaccgtgcccttcgactgctccaagaatcaggaaacggctttgtc
cgccacaacgtggggcacctgagcagaatctacccggctggatggagaacagactcctcc
aactacagccccgtggagatgtggaatgggggctgccagatcgtggccctgaatttccag
acacctgggccagagatggacgtgtatcagggtcgcttccaggacaacggggcctgtggg
tacgtgctgaagcccgccttcctgcgagaccccaacggcacctttaacccccgcgccctg
gctcaggggccctggtgggcacggaagcggctcaacatcagggtcatttcggggcagcag
ctgccaaaagtcaacaagaataagaattcaattgtggaccccaaagtgacagtggagatc
catggcgtgagccgggacgtggccagccgccagactgctgtcatcaccaacaatggtttc
aacccatggtgggacacggagtttgcgtttgaggtagttgtgcctgaccttgccctcgtc
cgcttcttggtggaagattatgatgcctcctccaagaatgacttcattggccagagtacc
atccccttgaacagcctcaagcaaggataccgccatgtccacctcatgtctaagaacggg
gaccagcatccatcagccaccctctttgtgaagatctccctccaggactag

DBGET integrated database retrieval system