KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101140350Help
Entry
101140350         CDS       T02442                                 

Gene name
PLCB2
Definition
(RefSeq) phospholipase C beta 2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00562  Inositol phosphate metabolism
ggo01100  Metabolic pathways
ggo04015  Rap1 signaling pathway
ggo04020  Calcium signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04062  Chemokine signaling pathway
ggo04070  Phosphatidylinositol signaling system
ggo04071  Sphingolipid signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04310  Wnt signaling pathway
ggo04371  Apelin signaling pathway
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04621  NOD-like receptor signaling pathway
ggo04713  Circadian entrainment
ggo04720  Long-term potentiation
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04726  Serotonergic synapse
ggo04728  Dopaminergic synapse
ggo04730  Long-term depression
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04919  Thyroid hormone signaling pathway
ggo04921  Oxytocin signaling pathway
ggo04922  Glucagon signaling pathway
ggo04924  Renin secretion
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo04934  Cushing's syndrome
ggo04961  Endocrine and other factor-regulated calcium reabsorption
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo05010  Alzheimer's disease
ggo05016  Huntington's disease
ggo05142  Chagas disease (American trypanosomiasis)
ggo05143  African trypanosomiasis
ggo05146  Amoebiasis
ggo05200  Pathways in cancer
Module
ggo_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101140350 (PLCB2)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    101140350 (PLCB2)
   04310 Wnt signaling pathway
    101140350 (PLCB2)
   04371 Apelin signaling pathway
    101140350 (PLCB2)
   04020 Calcium signaling pathway
    101140350 (PLCB2)
   04070 Phosphatidylinositol signaling system
    101140350 (PLCB2)
   04072 Phospholipase D signaling pathway
    101140350 (PLCB2)
   04071 Sphingolipid signaling pathway
    101140350 (PLCB2)
   04022 cGMP - PKG signaling pathway
    101140350 (PLCB2)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    101140350 (PLCB2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101140350 (PLCB2)
   04621 NOD-like receptor signaling pathway
    101140350 (PLCB2)
   04062 Chemokine signaling pathway
    101140350 (PLCB2)
  Endocrine system
   04911 Insulin secretion
    101140350 (PLCB2)
   04922 Glucagon signaling pathway
    101140350 (PLCB2)
   04912 GnRH signaling pathway
    101140350 (PLCB2)
   04915 Estrogen signaling pathway
    101140350 (PLCB2)
   04921 Oxytocin signaling pathway
    101140350 (PLCB2)
   04926 Relaxin signaling pathway
    101140350 (PLCB2)
   04918 Thyroid hormone synthesis
    101140350 (PLCB2)
   04919 Thyroid hormone signaling pathway
    101140350 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    101140350 (PLCB2)
   04916 Melanogenesis
    101140350 (PLCB2)
   04924 Renin secretion
    101140350 (PLCB2)
   04925 Aldosterone synthesis and secretion
    101140350 (PLCB2)
   04927 Cortisol synthesis and secretion
    101140350 (PLCB2)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101140350 (PLCB2)
   04270 Vascular smooth muscle contraction
    101140350 (PLCB2)
  Digestive system
   04970 Salivary secretion
    101140350 (PLCB2)
   04971 Gastric acid secretion
    101140350 (PLCB2)
   04972 Pancreatic secretion
    101140350 (PLCB2)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101140350 (PLCB2)
  Nervous system
   04724 Glutamatergic synapse
    101140350 (PLCB2)
   04725 Cholinergic synapse
    101140350 (PLCB2)
   04728 Dopaminergic synapse
    101140350 (PLCB2)
   04726 Serotonergic synapse
    101140350 (PLCB2)
   04720 Long-term potentiation
    101140350 (PLCB2)
   04730 Long-term depression
    101140350 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    101140350 (PLCB2)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101140350 (PLCB2)
  Environmental adaptation
   04713 Circadian entrainment
    101140350 (PLCB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101140350 (PLCB2)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    101140350 (PLCB2)
   05016 Huntington's disease
    101140350 (PLCB2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101140350 (PLCB2)
   04934 Cushing's syndrome
    101140350 (PLCB2)
  Infectious diseases
   05163 Human cytomegalovirus infection
    101140350 (PLCB2)
   05146 Amoebiasis
    101140350 (PLCB2)
   05142 Chagas disease (American trypanosomiasis)
    101140350 (PLCB2)
   05143 African trypanosomiasis
    101140350 (PLCB2)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101140350 (PLCB2)
Membrane trafficking [BR:ggo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101140350 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101140350 (PLCB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLC-beta_C PI-PLC-X PI-PLC-Y EF-hand_like C2 Gp58
Motif
Other DBs
NCBI-GeneID: 101140350
NCBI-ProteinID: XP_004056019
Ensembl: ENSGGOG00000000759
UniProt: G3QEQ0
Position
15
AA seq 1185 aa AA seqDB search
MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKVWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPEPVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINAQRGQLSPEGMVWFLCGPEN
SVLAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPIILSFENHVDSPRQQAKM
AEYCRTIFGDMLLTEPLEKFPLKPGVPLPSPEDLRGKILIKNKKNQFSGSTSSSKDTGGE
AEGSSPPSAPAGEGTVWAGEEGTELEEEEVEEEEEEESGNLDEEEIKKMQSDEGTAGLEV
TAYEEMSSLVNYIQPTKFISFEFSAQKNRSYVISSFTELKAFDLLSKASVQFVDYNKRQM
SRIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMAVFEFNGQSGYLLKHEF
MRRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRT
KLSPSTNSINPVWKEEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINALNSGYHHL
CLHSESNMPLTMPALFIFLEMKDYIPGAWADLTVALANPIKFFSAHDTKSVKLKEAMGGL
PEKPFPLASPVASQVNGALAPTSNGSPAARAGAREEAMKEAAEPRTASLEELRELKGVVK
LQRRHEKELRELERRGARRWEELLQRGAAQLAELQPPGVGGVGACKLGPGKGSRKKRSLP
REESAGASPGEGPEGVDGRVRELKDRLELELLRQGEEQYECVLKRKEQHAAEQISKMMEL
AREKQAAELKALKETSENDTKEMKKKLETKRLERIQGMTKVTTDKMAQERLKREINNSHI
QEVVQVIKQMTENLKRHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAEVKE
VVRVYLRTCFPSEAKDKPERACECPPELCEQDPLIAKADAQESRL
NT seq 3558 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgctcaaccctgtcctgctgccccccaaggtgaaggcctatctgagccaaggg
gagcgcttcatcaaatgggatgatgaaactacagttgcctctccagttatcctccgtgtg
gatcctaagggctactacttgtactggacgtatcaaagtaaggagatggagtttctggat
atcaccagcatccgggatactcgctttgggaagtttgccaagatgcccaagagccagaag
ctccgggacgtcttcaacatggactttcctgacaacagtttcctgctgaagacactcacg
gtggtgtccggcccggacatggtggacctcaccttccacaacttcgtctcctacaaggag
aatgtgggcaaggtctgggctgaggacgtactggccctagtcaaacatccgctgacggcc
aacgcctcccgcagcaccttcctggacaagatccttgtgaagctcaagatgcagctcaac
tctgaagggaagattccggtgaagaactttttccagatgtttcctgctgaccgcaagcgg
gtggaagctgctctcagtgcctgccacctccccaaaggcaaaaatgacgccatcaatcct
gaggacttcccagaacctgtctacaagagtttcctcatgagcctctgtcctcggccagaa
atagatgagatcttcacttcttaccatgctaaggccaaaccctacatgacgaaggagcac
ctgaccaaattcatcaaccagaaacagcgggactcccggcttaactccctgctgttcccg
ccagcacggcctgaccaggtgcagggcctcatcgacaagtatgagcccagtggcatcaat
gcacagaggggccagctgtcacctgaaggcatggtctggtttctctgtgggccagagaac
agcgtgctggcccaggacaagctgctgctccaccacgacatgacgcagccactcaatcat
tacttcatcaactcgtcccacaacacctacctgacagccggccagttctcaggcctctcc
tcggctgagatgtaccgccaggtgctgctctctggctgccgttgcgtggagctagactgc
tggaaggggaaaccccctgacgaggagcccattatcacccatggcttcaccatgaccaca
gacatcttcttcaaagaagcaattgaggctattgcagaaagtgcctttaagacctccccc
tatcccatcatcctgtcgtttgagaaccatgtggactcaccccgccagcaggctaagatg
gctgagtattgccggacgatctttggggatatgctgctcacagagcccctggaaaagttc
ccactaaaaccaggtgtccccctgcccagccctgaggatctcaggggcaagatcctcatc
aagaacaagaagaaccagttttctggctccacctcctccagtaaggatactggtggggag
gctgagggcagcagcccacctagtgcccctgcaggtgagggcacagtgtgggctggcgag
gaagggactgagctggaggaggaggaggtggaagaggaagaagaggaggagtcaggaaac
ctggatgaagaagagattaagaagatgcagtcggatgagggcacagcgggcctggaagtg
acggcttatgaggagatgtccagcctagtcaattacatccagcccaccaagttcatctcc
tttgagttctctgcccaaaagaaccgaagttatgtcatctcgtccttcacagagctcaag
gcatttgacctgctctccaaggcctcggtgcagtttgtggactacaacaagcgccagatg
agccgcatttaccccaagggaacccgcatggactcctccaactacatgccccagatgttc
tggaatgctggatgccagatggttgccctcaacttccagacgatggacttgcccatgcag
cagaacatggcagtgtttgagttcaacgggcagagtggctacctcctcaagcatgagttc
atgcgccggccggacaagcagttcaaccccttctcagtggaccgcatcgacgtggtggtg
gccaccaccctttccattacggtgatctctgggcagttcctgtcagaacgcagcgtgcgc
acctatgtggaagtggagctgtttggccttcctggggaccccaagaggcgctatcgaact
aagctgtcacccagtaccaactccatcaatcctgtctggaaggaggaaccctttgtcttt
gagaagatcttgatgcctgagctggcctccctcagagtggctgtgatggaggaaggcaac
aagtttcttggacaccgcatcatccccatcaatgccctaaattctgggtaccaccacctg
tgcctgcacagtgagagcaacatgcccctcaccatgcctgcgctcttcatcttcctggag
atgaaggactacatacctggtgcttgggcagatctcactgtggccctcgccaaccccatt
aagttcttcagtgcccatgacacgaagtctgtgaagctcaaggaggccatgggaggtctg
cctgagaagcccttcccactggcgagtccagttgccagccaggtcaatggggcgttggcc
ccaacgagcaatgggtcaccagcagccagggccggggccagggaagaggctatgaaagaa
gctgcggagccgcggaccgccagcctggaggagctccgggagctaaagggcgtggtgaag
ctgcagcggcggcacgagaaggagctgcgagagttggagcggcgcggagcgcggcgctgg
gaggagctgctgcagcggggcgcggcgcagctggcggagctccagccaccgggcgtgggg
ggcgtcggggcctgcaagctcggtcccggcaagggctctcgcaagaagaggagcctgccc
cgcgaggagagcgccggagcctcgccgggcgagggccctgagggcgtggacgggcgcgtg
cgggagctgaaagacaggctggagctggagctgctgcggcagggcgaggagcagtacgag
tgcgttctgaagcgcaaggagcagcacgcggccgagcaaatctccaaaatgatggagctg
gccagagagaaacaggcggcagagctgaaggccctgaaggagacgtcggagaacgacacc
aaagagatgaagaaaaagctggagacaaagagactggagcggatccagggcatgaccaaa
gtcaccacagacaagatggcccaggagaggttgaagagagagattaacaattcccacatc
caggaagtagtacaggtgatcaagcagatgacggagaacttgaagaggcaccaggagaag
ctggaggagaagcaggcggcttgcctggaacagatacgggagatggaaaagcagttccag
aaggaggcgctggcagagtacgaggccaggatgaagggtctggaggcagaggtgaaggag
gtggtgagggtctacctcaggacctgctttccctctgaagccaaggacaagcctgagagg
gcctgcgagtgccccccagagctgtgtgagcaggacccactcatagcaaaggcagatgcc
caggagagccgcctctga

DBGET integrated database retrieval system