KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101141374Help
Entry
101141374         CDS       T02442                                 

Gene name
UGT2B4
Definition
(RefSeq) UDP glucuronosyltransferase family 2 member B4
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00040  Pentose and glucuronate interconversions
ggo00053  Ascorbate and aldarate metabolism
ggo00140  Steroid hormone biosynthesis
ggo00830  Retinol metabolism
ggo00860  Porphyrin and chlorophyll metabolism
ggo00980  Metabolism of xenobiotics by cytochrome P450
ggo00982  Drug metabolism - cytochrome P450
ggo00983  Drug metabolism - other enzymes
ggo01100  Metabolic pathways
ggo05204  Chemical carcinogenesis
Module
ggo_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101141374 (UGT2B4)
   00053 Ascorbate and aldarate metabolism
    101141374 (UGT2B4)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101141374 (UGT2B4)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101141374 (UGT2B4)
   00860 Porphyrin and chlorophyll metabolism
    101141374 (UGT2B4)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101141374 (UGT2B4)
   00982 Drug metabolism - cytochrome P450
    101141374 (UGT2B4)
   00983 Drug metabolism - other enzymes
    101141374 (UGT2B4)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    101141374 (UGT2B4)
Enzymes [BR:ggo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101141374 (UGT2B4)
Glycosyltransferases [BR:ggo01003]
 Others
  Hydrophobic molecule
   101141374 (UGT2B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4 Pro_3_hydrox_C
Motif
Other DBs
NCBI-GeneID: 101141374
NCBI-ProteinID: XP_018880480
Ensembl: ENSGGOG00000011438
UniProt: G3RWI1
Position
4
AA seq 528 aa AA seqDB search
MPMKWTSALLLIQLSCYFSSGSCGKVLVWPTEFSHWMNIKTILDELVQRGHEVTVLASSA
SISFDPNSPSTLKFEVYPVSLTKTEFEDIIKQLVKRWAELPKDTFWSYFSQVQEIMWTFN
DILRKFCKDIVSNKKLMKKLQESRFDVVLADALFPFGELLAELLKIPFVYSLRFSPGYTI
EKHSGGLLFPPSYVPVVMSELSDQMTFIERVKNMIYVLYFEFWFQIFDMKKWDQFYSEVL
GRPTTLSETMAKADIWLIRNNWDFQFPHPLLPNVEFVGGLHCKPAKPLPKEMEEFVQSSG
ENGVVVFSLGSMVSNTSEERANVIASALAKIPQKVLWRFDGNKPDTLGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGAAVSLDFQTM
SSTDLLNALKTVINDPLYKENAMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
HDLTWFQYHSLDVIGFLLACVATVIFIITKCLFCVWKFARTAKKGKRD
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcctatgaaatggacttcagctcttctgctgatacagctgagctgttactttagctct
gggagttgtggaaaggtgctggtgtggcccacagaattcagccactggatgaatataaag
acaatcctggatgaacttgtccagagaggtcatgaggtgactgtattggcgtcttcagct
tccatttcttttgatcccaacagcccatctactcttaaatttgaagtttatcctgtatct
ttaactaaaactgagtttgaggatattatcaagcagctggttaagagatgggcagaactt
ccaaaagacacattttggtcatatttttcacaagtacaagaaatcatgtggacatttaat
gacatacttagaaagttctgtaaggatatagtttcaaataagaaacttatgaagaaacta
caggagtcaagatttgatgttgttcttgcagatgctcttttcccctttggtgagctgctg
gccgagttacttaaaataccctttgtctacagcctccgcttctctcctggctacacaatt
gaaaagcatagtggaggacttctgttccctccttcctatgtgcctgttgttatgtcagaa
ctaagtgaccaaatgactttcatagagagggtaaaaaatatgatctatgtgctttatttt
gaattttggttccaaatatttgacatgaagaagtgggatcagttctacagtgaagttcta
ggaagacccactacgttatctgagacaatggcaaaagctgacatatggcttattcgaaac
aactgggattttcaatttcctcacccactcttaccaaatgttgagttcgttggaggactc
cactgcaaacctgccaaacccctaccgaaggaaatggaagagtttgttcagagctctgga
gaaaatggtgttgtggtgttttctctggggtcgatggtcagtaacacgtcagaagaaagg
gccaatgtaattgcatcagcccttgccaagatcccacaaaaggttctgtggagatttgat
gggaataaaccagatactttaggactcaatactcggctgtacaagtggataccccagaat
gaccttcttggtcacccaaaaaccagagcttttataactcacggtggagccaatggcatc
tatgaggcaatctaccatggaatccctatggtgggcgttccattgtttgcagatcaacct
gataacattgcacacatgaaggccaagggagcagctgttagtttggacttccagacaatg
tcgagtacagacttactcaacgcactgaagacagtaattaatgatcctttatataaagag
aatgctatgaaattatcaagaattcatcatgatcaaccagtgaagcccctggatcgagca
gtcttctggattgaatttgtcatgcgccataaaggagccaagcaccttcgggttgcagcc
cacgacctcacctggttccagtaccactctttggatgtgattgggttcctgctggcctgt
gtggcaactgtgatattcatcatcacaaaatgtctgttttgtgtctggaagtttgctaga
acagcaaagaaggggaaaagagattaa

DBGET integrated database retrieval system