KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101141773Help
Entry
101141773         CDS       T02442                                 

Gene name
TNFRSF13C
Definition
(RefSeq) TNF receptor superfamily member 13C
  KO
K05151  tumor necrosis factor receptor superfamily member 13C
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04060  Cytokine-cytokine receptor interaction
ggo04064  NF-kappa B signaling pathway
ggo04672  Intestinal immune network for IgA production
ggo05166  Human T-cell leukemia virus 1 infection
ggo05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101141773 (TNFRSF13C)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101141773 (TNFRSF13C)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    101141773 (TNFRSF13C)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    101141773 (TNFRSF13C)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101141773 (TNFRSF13C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ggo04050]
    101141773 (TNFRSF13C)
   04090 CD molecules [BR:ggo04090]
    101141773 (TNFRSF13C)
Cytokine receptors [BR:ggo04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   101141773 (TNFRSF13C)
CD molecules [BR:ggo04090]
 Proteins
  101141773 (TNFRSF13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BaffR-Tall_bind stn_TNFRSF12A BatA DUF4079 SKG6 DUF4381 SIT
Motif
Other DBs
NCBI-GeneID: 101141773
NCBI-ProteinID: XP_018873579
Position
22
AA seq 175 aa AA seqDB search
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAALQPQESVGAGAGE
AALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKEAPEPLDK
VIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgagggccccggagcctgcggggcagggacgcgccagcccccacgccctgcgtc
ccggccgagtgcttcgacctgttggtccgccactgcgtggcctgcgggctcctgcgcacg
ccgcggccgaaaccggcggcgctgcagccgcaggagtcggtgggcgcgggggccggcgag
gcggcgctgcccctgcccgggctgctctttggcgcccccgcgctgctgggcctggcactg
gtcctggcgctggtcctggtgggcctggtgagctggaggcggcgacagcggcggcttcgc
ggcgcgtcctccgcagaggcccccgacggagacaaagaggccccagagcccctggacaag
gtcatcattctgtctccgggaatctctgatgccacagctcctgcctggcctcctcctggg
gaagacccaggaaccaccccacctggccacagtgtccctgtgccagccacggaactgggc
tccactgaactggtgaccaccaagacggccggccctgagcaacaatag

DBGET integrated database retrieval system