KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101142418
Entry
101142418         CDS       T02442                                 

Definition
(RefSeq) cytochrome P450 11B2, mitochondrial isoform X1
  KO
K07433  steroid 11beta-monooxygenase / corticosterone 18-monooxygenase [EC:1.14.15.4 1.14.15.5]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00140  Steroid hormone biosynthesis
ggo01100  Metabolic pathways
ggo04925  Aldosterone synthesis and secretion
Module
ggo_M00108  C21-Steroid hormone biosynthesis, progesterone => corticosterone/aldosterone
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    101142418
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    101142418
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ggo00199]
    101142418
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.4  steroid 11beta-monooxygenase
     101142418
    1.14.15.5  corticosterone 18-monooxygenase
     101142418
Cytochrome P450 [BR:ggo00199]
 Cytochrome P450, animal type
  CYP11 family
   101142418
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 101142418
NCBI-ProteinID: XP_004047649
Ensembl: ENSGGOG00000007547
UniProt: G3RC58
Position
8
AA seq 503 aa
MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQQPGNRWLRLLQIWREQG
YEHLHLEMHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPRRMSLEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALRKKVLQNA
RGSLTMDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFM
PRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFYRPQHYTGIVAELLLKAELS
LEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQALRQESLAAAASISEHPQKATT
ELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRP
ERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQED
IKMVYSFILRPGTSPLLTFRAIN
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggcactcagggcaaaggcagaggtgtgcgtggcagcgccctggctgtccctgcaaagg
gcacgggcactgggcactagagccgctcgggcccctaggacagtgctgccgtttgaagcc
atgccccagcagccaggcaacaggtggctgaggctgctgcagatctggagggagcagggt
tatgagcacctgcacctggagatgcaccagaccttccaggagctggggcccattttcagg
tacgacttgggaggagcaggcatggtgtgtgtgatgctgccggaggacgtggagaagctg
cagcaggtggacagcctgcatccccgcaggatgagcctggagccctgggtggcctacaga
caacatcgtgggcacaaatgtggcgtgttcttgttgaatgggcctgaatggcgcttcaac
cgattgcggctgaacccagatgtgctgtcgcccaaggccgtgcagaggttcctcccgatg
gtggatgctgtggccagggacttttcccaggccctgaggaagaaggtgctgcagaacgcc
cgggggagcctgaccatggacgtccagcccagcatcttccactacaccatagaagccagc
aacttagccctttttggagagcggctgggcctggttggccacagccccagttctgccagc
ctgaacttcctccatgccctggaggtcatgttcaaatccaccgtccagctcatgttcatg
cccaggagcctgtctcgctggatcagccccaaggtgtggaaggagcactttgaggcctgg
gactgcatcttccagtatggtgacaactgtatccagaaaatctaccaggaactggccttc
taccgccctcaacactacacaggcatcgtggcagagctcctgttgaaggcggaactgtca
ctagaagccatcaaggccaactctatggaactcactgcagggagcgtggacacgacggcg
tttcccttgctgatgacgctctttgagctggctcggaaccccgacgtgcagcaggccctg
cgccaggagagcctggccgccgcagccagcatcagtgaacacccccagaaggcaaccacc
gagctgcctttgctgcgggcggccctcaaggagaccttgaggctctaccccgtgggtctg
tttttggagcgagtggcgagctcagacttggtgcttcagaactaccacatcccagctggg
acattggtgcgcgtgttcctgtattctctgggtcgcaaccccgccttgttcccgaggccg
gagcgctataacccccagcgctggctagacatcaggggctccggcaggaacttccaccac
gtgccctttggctttggcatgcgccagtgcctcgggcggcgcctggcagaagcagagatg
ctgctgctgctgcaccacgtgctgaagcacttcctggtggagacactaacccaagaggac
ataaagatggtctacagcttcatattgaggcctggcacgtcccccctcctcactttcaga
gcgatcaactag

DBGET integrated database retrieval system