KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101143242Help
Entry
101143242         CDS       T02442                                 

Gene name
QRSL1
Definition
(RefSeq) glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00970  Aminoacyl-tRNA biosynthesis
ggo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    101143242 (QRSL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ggo03029]
    101143242 (QRSL1)
Enzymes [BR:ggo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     101143242 (QRSL1)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     101143242 (QRSL1)
Mitochondrial biogenesis [BR:ggo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    101143242 (QRSL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 101143242
NCBI-ProteinID: XP_004044517
Ensembl: ENSGGOG00000008261
UniProt: G3SBQ6
Position
6
AA seq 528 aa AA seqDB search
MLGRTLREVSAALKQGQITPTELCQKCLSLIKKTKFLNAYITVSEEVALKQAEESEKRYK
NGQSLGDLDGIPIAVKDNFSTSGIETTCASNMLKGYIPPYNATVVQKLLDQGALLMGKTN
LDEFAMGSGSTDGVFGPVKNPWSYSKQYREKRKQNPHSENEDSDWLITGGSSGGSAAAVS
AFTCYAALGSDTGGSTRNPAAHCGLVGFKPSYGLVSRHGLIPLVNSMDVPGILTRCVDDA
AIVLGALAGPDPRDSTTVHDPINKPFMLPSLADVSKLCIGIPKEYLVPELSSEVQSLWSK
AADLFESEGAKVIEVSLPHTSYSIVCYHVLCTSEVASNMARFDGLQYGHRCDIDVSTEAM
YAATRREGFNDVVRGRILSGNFFLLKENYENYFVKAQKVRRLIANDFINAFNSGVDVLLT
PTTLSEAVPYLEFIKEDNRTRSAQDDIFTQAVNMAGLPAVSIPVALSNQGLPIGLQFIGR
AFCDQQLLTVAKWFEKQVQFPVIQLQELMDDCSAVLENEKLASVSLKQ
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgctgggccggaccctccgagaagtttctgcggcactgaaacaaggccaaattacacca
acagagctctgtcaaaaatgtctctctcttatcaagaagaccaagtttctaaatgcctac
attactgtgtcagaagaggtggccttaaaacaagctgaagaatcagaaaagagatataag
aatggacagtcacttggggatttagatggaattcctattgcagtaaaagacaacttcagc
acttctggcattgagacaacatgtgcatcaaatatgctgaaaggttatataccaccttat
aatgctacagtagttcagaagttgttggatcagggagctctactaatgggaaaaacaaat
ttagatgagtttgctatgggatctgggagcacagatggtgtatttggaccagttaaaaac
ccctggagttattcaaaacaatatagagaaaagaggaagcagaatccccacagtgagaat
gaagattcagactggctgataactggaggaagctcaggtgggagtgcagctgctgtatca
gcgttcacatgctacgcggctttaggatcagatacaggaggatcgaccagaaatcctgct
gcccactgtgggcttgttggtttcaaaccaagctatggcttagtttcccgtcatggtctc
attcccctggtgaattcgatggatgtgccaggaatcttaaccagatgtgtggatgatgca
gcaattgtgttgggtgcactggctggacctgaccccagggactctaccacagtacatgac
cctattaataaaccattcatgcttcccagtttggcagatgtgagcaaactatgtatagga
attccaaaggaatatcttgtaccggaattatcaagtgaagtacagtctctttggtccaaa
gctgctgacctctttgagtctgagggggccaaagtaattgaagtatcccttcctcacacc
agttattcaattgtctgctaccatgtattgtgcacatcagaagtggcatcgaatatggca
agatttgatgggctacaatatggtcacagatgtgacattgatgtgtccactgaagccatg
tatgctgcaaccagacgagaagggtttaatgatgtggtgagaggaagaattctctcagga
aactttttcttattaaaagaaaactatgaaaattattttgtcaaagcacagaaagtgaga
cgcctcattgctaatgacttcataaatgcttttaactctggagtagatgtcttgctaact
cccaccaccttgagtgaggcagtaccatacttggagttcatcaaagaggacaacagaacc
cgaagtgcccaggatgatatttttacacaagctgtaaatatggcaggattgccagcagtg
agtatccctgttgcactctcaaaccaagggttgccaataggactgcagtttattggacgt
gcgttttgtgaccagcagcttcttacagtagcaaaatggtttgaaaaacaagtacagttt
cctgttattcaacttcaagaactcatggatgattgttcagcagtccttgaaaatgaaaag
ttagcctctgtctctctaaaacagtaa

DBGET integrated database retrieval system