KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101144263Help
Entry
101144263         CDS       T02442                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00010  Glycolysis / Gluconeogenesis
ggo00562  Inositol phosphate metabolism
ggo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101144263 (MINPP1)
   00562 Inositol phosphate metabolism
    101144263 (MINPP1)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     101144263 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     101144263 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708 SID
Motif
Other DBs
NCBI-GeneID: 101144263
NCBI-ProteinID: XP_004049779
Ensembl: ENSGGOG00000007426
UniProt: G3QWU7
Position
10
AA seq 487 aa AA seqDB search
MLRAPGCLLRTSVAPAAALAAALLSSLARCSLLEPRDPVASSLSPYFGTKTRYEDVNPVL
LSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTAKQIRKLRQLHGLLQARGSRDGGAS
STGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLI
TSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCKKFLTEVE
KNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSP
WCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPI
SSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKEQMHRKFRSGLIVPYASNLIFVLY
HCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARA
NSTSDEL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcgcgcccggctgcctcctccggacctccgtagcgcctgccgcggccctggct
gcggcgctgctctcgtcgcttgcgcgctgctctcttctagagccgagggacccggtggcc
tcgtcgctcagcccctatttcggcaccaagactcgctacgaagatgtcaaccccgtgcta
ttgtcgggccccgaggctccgtggcgggaccctgagctgctggaggggacctgcaccccg
gtgcagctggtcgccctcattcgccacggcacccgctaccccacggccaaacagatccgc
aagctgaggcagctgcacgggttgctgcaggcccgcgggtccagggatggcggggccagt
agtaccggcagccgcgacctgggtgcagcgctggccgactggcctttgtggtacgcggac
tggatggacgggcagctagtagagaagggacggcaggatatgcgacagctggcgctgcgt
ctggcctcgctcttcccggcccttttcagccgtgagaactacggccgcctgcggctcatc
accagttccaagcaccgctgcatggatagcagcgccgccttcctgcaggggctgtggcag
cactaccaccctggcttgccgccgcccgacgtcgcagatatggagtttggacctccaaca
gttaatgataaactaatgagattttttgatcactgtaagaagtttttaactgaagtagaa
aaaaatgctacagctctttatcatgtggaagccttcaaaactggaccagaaatgcagaac
attttaaaaaaagttgcagctactttgcaagtgccagtaaatgatttaaatgcagattta
attcaagtagcctttttcacctgttcatttgacctggcaattaaaggtgttaaatctcct
tggtgtgatgtttttgacatagatgatgcaaaggtattagaatatttaaatgatctgaaa
caatattggaaaagaggatatgggtatactattaacagtcgatccagctgcaccttgttt
caggatatctttcagcacttggacaaagcagttgaacagaaacaaaggtctcagccaatt
tcttctccagtcatcctccagtttggtcatgcagagactcttcttccactgctttctctc
atgggctacttcaaagacaaggaacccctaacggcgtacaattacaaagaacaaatgcat
cggaagttccgaagtggtctcattgtaccttatgcctcgaacctgatatttgtgctttac
cactgtgaaaatgctaagactcctaaagaacaattccgagtgcagatgttattaaatgaa
aaggtgttacctttggcttactcacaagaaactgtttcattttatgaagatctgaagaac
cactacaaggacatccttcagagttgtcaaaccagtgaagaatgtgaattagcaagggct
aacagtacatctgatgaactatga

DBGET integrated database retrieval system