KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101144360Help
Entry
101144360         CDS       T02442                                 

Gene name
MTMR7
Definition
(RefSeq) myotubularin related protein 7
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00562  Inositol phosphate metabolism
ggo01100  Metabolic pathways
ggo04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101144360 (MTMR7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    101144360 (MTMR7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ggo01009]
    101144360 (MTMR7)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     101144360 (MTMR7)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     101144360 (MTMR7)
Protein phosphatases and associated proteins [BR:ggo01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    101144360 (MTMR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM DSPc Y_phosphatase Y_phosphatase3 CREPT DUF5320 PH_BEACH FapA CCDC53
Motif
Other DBs
NCBI-GeneID: 101144360
NCBI-ProteinID: XP_018887827
Ensembl: ENSGGOG00000010545
UniProt: G3R4S5
Position
8
AA seq 660 aa AA seqDB search
MEHIRTPKVENVRLVDRVSPKKAALGTLYLTATHVIFVENSPDTRKETWILHSQISTIEK
QATTATGCPLLIRCKNFQIIQLIIPQERDCHDVYISLIRLARPVKYEELYCFSFNPMLDK
EEREQGWVLIDLSEEYKRMGLPNHYWQLSDVNRDYRVCDSYPTELYVPKSATAHIIVGSS
KFRSRRRFPVLSYYYKDNHASICRSSQPLSGFSARCLEDEQMLQAIRKANPGSDFVYVVD
TRPKLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRNSLQKMLEVCELKSPSMSDF
LWGLENSGWLRHIKAIMDAGIFIAKAVSEEGASVLVHCSDGWDRTAQVCSVASLLLDPHY
RTLKGFMVLIEKDWISFGHKFNHRYGNLDGDPKEISPVIDQFIECVWQLMEQFPCAFEFN
ERFLIHIQHHIYSCQFGNFLCNSQKERRELKIQERTYSLWAHLWKNRADYLNPLFRADHS
QTQGTLHLPTTPCNFMYKFWSGMYNRFEKGMQPRQSVTDYLMAVKEETQQLEEELEALEE
RLEKIQNVQLNCTKVKSKQSEPSKHSGFSTSDNSIANTPQDYSGNMKSFPSRSPSQGDED
SALILTQDNLKSSDPDLSANSDQESGVEDLSCRSPSGGEHAPSEDSGKDRDSDEAVFLTA
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggagcacatccgcacgcccaaggttgaaaatgtccgcttggtagatcgagtgtctcct
aaaaaagcagctctaggtactttgtatttgacggctacccatgtcatattcgtggagaat
tcacctgacacaagaaaagaaacatggattcttcacagtcagatttccaccattgagaaa
caggcaacaactgctaccggatgccctctgctgattcgctgcaagaactttcagataata
cagctcatcatacctcaggaaagagattgccacgacgtgtacatctccctgatacgcctt
gcaaggccagtgaaatatgaggagttatactgcttttcattcaaccccatgctggataaa
gaagaaagagagcaaggctgggtgctgatcgatcttagtgaagaatacaagcggatgggc
ctccctaatcattactggcagctcagcgatgtgaatagagactacagagtctgtgactct
tatcctactgaactgtacgttcccaaatcggccacggcacacatcatagtggggagttcc
aaattccggagtagacggcgatttcctgtcctttcttactattataaagataaccacgcc
tccatctgccggagcagccagcccctgtccggcttcagtgcccggtgcctagaggacgag
cagatgctccaggccattaggaaagccaatccaggaagtgacttcgtttatgtcgttgac
acccggcctaaacttaatgcaatggcaaatcgtgctgcagggaaaggctatgagaatgaa
gacaattattccaatatcaagtttcagtttatcgggatagagaacatccatgtcatgagg
aacagtctgcagaaaatgctggaagtgtgtgaacttaaatctccctccatgagtgatttc
ctgtggggtctggagaactctggctggttaaggcacattaaagccataatggatgcagga
atcttcattgcaaaggcagtgtcagaggaaggggcaagtgtgcttgttcactgttctgat
ggctgggacaggaccgctcaggtgtgctcggtggcaagcctgctgctggaccctcactac
cggactctgaagggcttcatggtattaattgaaaaggactggatttcctttggtcataag
tttaatcaccgatatggcaatctagatggtgacccaaaagaaatctctccagttattgac
cagttcattgagtgtgtttggcagttaatggaacaatttccctgtgcctttgagttcaat
gagaggtttttgattcacattcaacatcacatttattcctgccagtttggaaacttccta
tgtaacagccaaaaggagagacgagaactcaagattcaagaaagaacatactcattatgg
gctcacctgtggaagaatcgggccgactacctgaatcctctgtttagagctgatcacagc
cagactcagggaacccttcatctccctacaacaccatgtaacttcatgtacaagttttgg
agtggaatgtataaccgctttgaaaaggggatgcagccccgacaatcagttacagattac
ctaatggcagtgaaggaagaaactcagcagctagaggaagaactagaggccctggaagaa
aggctggaaaaaattcaaaacgtccagttaaattgcactaaggtgaagagtaagcaaagt
gagcccagcaagcactcagggttttctacctcagataacagcatagccaacactccccag
gattacagtgggaatatgaaatcatttccatcccggagcccttcacaaggcgatgaagat
tctgctctgattctaacccaagacaatctgaaaagttcagatccagatctgtcagccaac
agtgaccaagagtccggggtggaggatttgagctgtcggtctccaagtggtggtgagcat
gcaccgagtgaagatagtggcaaggaccgggattctgatgaagccgtgtttctcactgcc
tga

DBGET integrated database retrieval system