KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101144696Help
Entry
101144696         CDS       T02442                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04010  MAPK signaling pathway
ggo04014  Ras signaling pathway
ggo04015  Rap1 signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04066  HIF-1 signaling pathway
ggo04068  FoxO signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04150  mTOR signaling pathway
ggo04151  PI3K-Akt signaling pathway
ggo04152  AMPK signaling pathway
ggo04211  Longevity regulating pathway
ggo04213  Longevity regulating pathway - multiple species
ggo04520  Adherens junction
ggo04910  Insulin signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04923  Regulation of lipolysis in adipocytes
ggo04930  Type II diabetes mellitus
ggo04931  Insulin resistance
ggo04932  Non-alcoholic fatty liver disease (NAFLD)
ggo04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    101144696 (INSR)
   04015 Rap1 signaling pathway
    101144696 (INSR)
   04010 MAPK signaling pathway
    101144696 (INSR)
   04066 HIF-1 signaling pathway
    101144696 (INSR)
   04068 FoxO signaling pathway
    101144696 (INSR)
   04072 Phospholipase D signaling pathway
    101144696 (INSR)
   04022 cGMP - PKG signaling pathway
    101144696 (INSR)
   04151 PI3K-Akt signaling pathway
    101144696 (INSR)
   04152 AMPK signaling pathway
    101144696 (INSR)
   04150 mTOR signaling pathway
    101144696 (INSR)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    101144696 (INSR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101144696 (INSR)
   04923 Regulation of lipolysis in adipocyte
    101144696 (INSR)
   04913 Ovarian Steroidogenesis
    101144696 (INSR)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101144696 (INSR)
  Aging
   04211 Longevity regulating pathway - mammal
    101144696 (INSR)
   04213 Longevity regulating pathway - multiple species
    101144696 (INSR)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101144696 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101144696 (INSR)
   04931 Insulin resistance
    101144696 (INSR)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101144696 (INSR)
Protein kinases [BR:ggo01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   101144696 (INSR)
CD molecules [BR:ggo04090]
 Proteins
  101144696 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 101144696
NCBI-ProteinID: XP_018870011
Ensembl: ENSGGOG00000013703
Position
19
AA seq 1395 aa AA seqDB search
MGTLQRKLLIPAGCRVYRARDENTGPRFRVHEAGSAPDPSDASTMRLLTCLAFCSFSLLV
CPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVY
GLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCY
LATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSH
CQKVCPTICKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYH
FQDWRCVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNGFPRPMDGI
QTPHREGSASSHSHFIPKLTGYSLLSLDNLAAELEANLGLIEEISGYLKIRRSYALVSLS
FFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIH
KMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDL
LGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWT
QYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSD
PNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAG
ECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGDV
GNVTVAVPTVAAFPNTSSTSVPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQ
DTPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVS
YRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDY
LDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFP
CSVYVPDEWEVPREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRE
RIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPG
RPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYET
DYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLK
FVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSE
ENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGG
KKNGRILTLPRSNPS
NT seq 4188 nt NT seq  +upstreamnt  +downstreamnt
atgggtactttacagagaaagctactcatcccggctggctgcagagtttacagggcccga
gatgaaaacacagggcccaggtttcgtgtccatgaagccggctctgcccctgatccttct
gatgcatccaccatgcgtctgctcacctgtcttgctttctgttcattttctcttctagtg
tgtcccggcatggatatccggaacaacctcactaggttgcatgagctggagaattgctct
gtcatcgaaggacacttgcagatactcttgatgttcaaaacgaggcccgaagatttccga
gacctcagtttccccaaactcataatgatcactgattacttgctgctcttccgggtctat
gggctcgagagcctgaaggacctgttccccaacctcacggtcatccggggatcacgactg
ttctttaactacgcgctggtcatcttcgagatggttcacctcaaggaactcggcctctac
aacctgatgaacatcacccggggttctgtccgcatcgagaagaacaatgagctctgttac
ttggccactatcgactggtcccgtatcctggattccgtggaggataattacatcgtgttg
aacaaagatgacaacgaggagtgtggagacatctgtccgggtaccgcgaagggcaagacc
aactgccccgccaccgtcatcaatgggcagtttgtcgaacggtgttggactcatagtcac
tgccagaaagtttgcccgaccatctgtaagtcacacggctgcaccgccgaaggcctctgt
tgccacagcgagtgcctgggcaactgttctcagcccgacgaccccaccaagtgcgtggcc
tgccgcaacttctacctggacggcaggtgtgtggagacctgcccgcccccgtactaccac
ttccaggactggcgctgtgtgaacttcagcttctgccaggacctgcaccacaaatgcaag
aactcgcggaggcagggctgccaccagtacgtcattcacaacaacaagtgcatccctgag
tgtccctccgggtacacgatgaattccagcaatggcttcccaagaccaatggacggaatc
caaactccccatcgggaaggctcggccagttctcattctcatttcattccgaaactcact
ggatattctctcctttccttagacaatctggcagctgagctagaagccaacctcggcctc
attgaagaaatttcagggtatctaaaaatccgccgatcctacgctctggtgtcactttcc
ttcttccggaagttacgtctgattcgaggagagaccttggaaatcgggaactactccttc
tatgccttggacaaccagaacctaaggcagctctgggattggagcaaacacaacctcacc
atcactcaggggaaactcttcttccactataaccccaaactctgcttgtcagaaatccac
aagatggaagaagtttcaggaaccaaggggcgccaggagagaaacgacattgccctgaag
accaatggcgaccaggcatcctgtgaaaatgagttacttaaattttcttacattcggaca
tcttttgacaagatcttgctgagatgggagccgtactggccccccgacttccgagacctc
ttggggttcatgctgttctacaaagaggccccttatcagaatgtgacggagttcgacggg
caggatgcatgtggttccaacagttggacggtggtagacattgacccacccctgagatcc
aatgaccccaaatcacagaaccacccagggtggctgatgcggggtctcaagccctggacc
cagtatgccatcttcgtgaagaccctggtcaccttttcggatgaacgccggacctatggg
gccaagagtgacatcatttatgtccagacagatgccaccaacccctccgtgcccctggat
ccaatctcagtgtctaactcatcatcccagattattttgaagtggaaacccccctccgac
cccaatggcaacatcacccactacctggttttctgggagaggcaggcggaagacagtgag
ctgttcgagctggattattgcctcaaagggctgaagctgccctcgaggacctggtctcca
ccattcgagtctgaagattctcagaagcacaaccagagtgagtatgaggattcggccggc
gaatgctgctcctgtccaaagacagactctcagatcctgaaggagctggaggagtcctcg
tttaggaagacgtttgaggattacctgcacaacgtggttttcgtccccagaaaaacctct
tcaggcactggtgccgaggaccctaggccatctcggaaacgcaggtcccttggcgatgtt
gggaatgtgacggtggccgtgcccacggtggcagctttccccaacacttcctcaaccagc
gtgcccacgagtccagaggagcacaggccttttgagaaggtggtgaacaaggagtcgctg
gtcatctccggcttgcgacacttcacgggctatcgcatcgagctgcaggcttgcaaccag
gacacccctgaggaacggtgcagtgtggcagcctacgtcagtgccaggaccatgcctgaa
gccaaggctgatgacattgtcggccctgtgacgcatgaaatctttgagaacaacgtcgtc
cacttgatgtggcaggagccgaaggagcccaatggtctgatcgtgctgtatgaagtgagt
tatcggcgatatggtgatgaggagctgcatctctgcgtctcccgcaagcacttcgctctg
gaacggggctgcaggctgcgtggactgtcaccggggaactacagcgtgcgagtccgggcc
acctcccttgcgggcaacggctcttggacggaacccacctatttctacgtgacagactat
ttagatgtcccgtcaaatattgcaaaaattatcattggccccctcatctttgtctttctc
ttcagtgttgtgattggaagtatttatctattcctgagaaagaggcagccagatgggccg
ctgggaccgctttatgcttcttcaaaccctgagtatctcagtgccagtgatgtgtttcca
tgctctgtgtacgtgccggacgagtgggaggtgcctcgagagaagatcaccctccttcga
gagctggggcagggatccttcggcatggtgtatgagggcaatgccagggacatcatcaag
ggtgaggcagagacccgcgtggcggtgaagacggtcaacgagtcagccagtctccgagag
cggattgagttcctcaatgaggcctcggtcatgaagggcttcacctgccatcacgtggtg
cgcctcctgggagtggtgtccaagggccagcccacgctggtggtgatggagctgatggct
cacggagacctgaagagctacctccgttctctgcggccagaggctgagaataatcccggc
cgccctccccctacccttcaagagatgattcagatggcggcagagattgctgacgggatg
gcctacctgaacgccaagaagtttgtgcatcgggacctggcagcgagaaactgcatggtc
gcccatgattttactgtcaaaattggagactttggaatgaccagagacatctatgaaacg
gattactaccggaaagggggcaagggtctgctccctgtacggtggatggcgccggagtcc
ctgaaggatggggtcttcaccacttcttctgacatgtggtcctttggcgtggtcctttgg
gaaatcaccagcttggcagaacagccttaccaaggcctgtctaatgaacaggtgttgaaa
tttgtcatggatggagggtatctggatcaacccgacaactgtccagagagagtcactgac
ctcatgcgcatgtgctggcaattcaaccccaagatgaggccaaccttcctggagattgtc
aacctgctcaaggacgacctgcaccccagctttccagaggtgtcgttcttccacagcgag
gagaacaaggctcccgagagtgaggagctggagatggagtttgaggacatggagaatgtg
cccctggaccgctcctcgcactgtcagagggaggaggcggggggccgggatggagggtcc
tcgctaggtttcaagcggagctacgaggaacacatcccttacacacacatgaacggaggc
aagaaaaacgggcggattctgaccttgcctcggtccaatccttcctaa

DBGET integrated database retrieval system