KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101145558Help
Entry
101145558         CDS       T02442                                 

Gene name
GRIA1
Definition
(RefSeq) glutamate receptor 1 isoform X2
  KO
K05197  glutamate receptor 1
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04024  cAMP signaling pathway
ggo04080  Neuroactive ligand-receptor interaction
ggo04713  Circadian entrainment
ggo04720  Long-term potentiation
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04728  Dopaminergic synapse
ggo04730  Long-term depression
ggo05014  Amyotrophic lateral sclerosis (ALS)
ggo05031  Amphetamine addiction
ggo05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101145558 (GRIA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101145558 (GRIA1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    101145558 (GRIA1)
   04728 Dopaminergic synapse
    101145558 (GRIA1)
   04720 Long-term potentiation
    101145558 (GRIA1)
   04730 Long-term depression
    101145558 (GRIA1)
   04723 Retrograde endocannabinoid signaling
    101145558 (GRIA1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101145558 (GRIA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    101145558 (GRIA1)
  09165 Substance dependence
   05031 Amphetamine addiction
    101145558 (GRIA1)
   05033 Nicotine addiction
    101145558 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ggo04040]
    101145558 (GRIA1)
Ion channels [BR:ggo04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   101145558 (GRIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF659 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 101145558
NCBI-ProteinID: XP_004042911
Ensembl: ENSGGOG00000014845
Position
5
AA seq 906 aa AA seqDB search
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPAKIMQQWKSSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKW
WYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMP
LGATGL
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacatttttgccttcttctgcaccggtttcctaggcgcggtagtaggtgccaat
ttccccaacaatatccagatcgggggattatttccaaaccagcagtcacaggaacatgct
gcttttagatttgctttgtcgcaactcacagagcccccgaagctgctcccccagattgat
attgtgaacatcagcgacagctttgagatgacctatagattctgttcccagttctccaaa
ggagtctatgccatctttgggttttatgaacgtaggactgtcaacatgctgacctccttt
tgtggggccctccacgtctgcttcattacgccgagctttcccgttgatacatccaatcag
tttgtccttcagctgcgccctgaactgcaggatgccctcatcagcatcattgaccattac
aagtggcagaaatttgtctacatttatgatgccgaccggggcttatccgtcctgcagaaa
gtcctggacacagctgctgagaagaactggcaggtgacagcagtcaacattttgacaacc
acagaggagggataccggatgctctttcaggacctggagaagaaaaaggagcggctggtg
gtggtggactgtgaatcagaacgcctcaatgctatcttgggccagattataaagctggag
aagaatggcatcggctaccactacattcttgcaaatctgggcttcatggacattgactta
aacaaattcaaggagagtggcgccaatgtgacaggtttccagctggtgaactacacagac
actattccggccaagatcatgcagcagtggaagagtagtgatgctcgagaccacacacgg
gtggactggaagagacccaagtacacctctgcgctcacctacgatggggtgaaggtgatg
gctgaggctttccagagcctgcggaggcagagaattgatatatctcgccgggggaatgct
ggggattgtctggctaacccagctgttccctggggccaagggatcgacatccagagagct
ctgcagcaggtgcgatttgaaggtttgacaggaaatgtgcagtttaatgagaaaggacgc
cggaccaactacacgctccacgtgattgaaatgaaacatgacggcatccgaaagatcggt
tactggaatgaagatgataagtttgtccctgcagccaccgatgcccaagctgggggcgat
aattcaagtgttcagaacagaacatacatcgtcacaacaatcctagaagatccttatgtg
atgctcaagaagaacgccaatcagtttgagggcaatgaccgttacgagggctactgtgta
gagctggcggcagagattgccaagcacgtgggctactcctaccgtctggagattgtcagt
gatggaaaatacggagcccgagaccctgacacaaaggcctggaatggcatggtgggagag
ctggtctatggaagagcagatgtggctgtggctcccttaactatcactttggtccgggaa
gaagttatagatttctccaaaccatttatgagtttggggatctccatcatgattaaaaaa
ccacagaaatccaagccgggtgtcttctccttccttgatcctttggcttatgagatttgg
atgtgcattgtttttgcctacattggagtgagcgttgtcctcttcctggtcagccgcttc
agtccctatgaatggcacagtgaagagtttgaggaaggacgggaccagacaaccagtgac
cagtccaatgagtttgggatattcaacagtttgtggttctccctgggagccttcatgcag
caaggatgtgacatttctcccaggtccctgtctggtcgcatcgttggtggcgtctggtgg
ttcttcaccttaatcatcatctcctcatatacagccaatctggccgccttcctgaccgtg
gagaggatggtgtctcccattgagagtgcagaggacctagcgaagcagacagaaattgcc
tacgggacgctggaagcaggatctactaaggagttcttcaggaggtctaaaattgctgtg
tttgagaagatgtggacatacatgaagtcagcagagccatcagtttttgtgcggaccaca
gaggaggggatgattcgagtgaggaaatccaaaggcaaatatgcctacctcctggagtcc
accatgaatgagtacattgagcagcggaaaccctgtgacaccatgaaggtgggaggtaac
ttggattccaaaggctatggcattgcgacacccaaggggtctgccctgagaaatccagta
aacctggcagtgttaaaactgaacgagcaggggcttttggacaaattgaaaaacaaatgg
tggtacgacaagggcgagtgcggcagcgggggaggtgattccaaggacaagacaagcgct
ctgagcctcagcaatgtggcaggcgtgttctacatcctgatcggaggacttggactagcc
atgctggttgccttaatcgagttctgctacaaatcccgtagtgaatccaagcggatgaag
ggtttttgtttgatcccacagcaatccatcaacgaagccatacggacatcgaccctcccc
cgcaacagcggggcaggagccagcagcggcggcagtggagagaatggtcgggtggtcagc
catgacttccccaagtccatgcaatcgattccttgcatgagccacagttcagggatgccc
ttgggagccacgggattgtaa

DBGET integrated database retrieval system