KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101145695Help
Entry
101145695         CDS       T02442                                 

Gene name
BLVRA
Definition
(RefSeq) biliverdin reductase A
  KO
K00214  biliverdin reductase [EC:1.3.1.24]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00860  Porphyrin and chlorophyll metabolism
ggo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    101145695 (BLVRA)
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     101145695 (BLVRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biliv-reduc_cat GFO_IDH_MocA NAD_binding_3 NEXCaM_BD
Motif
Other DBs
NCBI-GeneID: 101145695
NCBI-ProteinID: XP_018887331
UniProt: A0A2I2Z6L1
Position
7
AA seq 296 aa AA seqDB search
MNTEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLE
DALSSQQVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKV
LHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLF
GELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLEN
VPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagagcccgagaggaagtttggcgtggtggtggttggtgttggccgagccggc
tccgtgcggatgagggacttgcggaatccacacccttcctcagcgttcctgaacctgatt
ggcttcgtgtcgagaagggagctcgggagcattgatggagtccagcagatttctttggag
gatgctctttccagccaacaggtggaggtcgcctatatctgcagtgagagctccagccat
gaggactacatcaggcagttccttaatgctggcaagcacgtccttgtggaataccccatg
acactgtcattggcggccgctcaggaactgtgggagctggctgagcagaaaggaaaagtc
ttgcacgaggagcatgttgaactcttgatggaggaattcgctttcctgaaaaaagaagtg
gtggggaaagacctgctgaaagggtcgctcctcttcacagctggcccgttggaagaagag
cggtttggcttccctgcattcagcggcatctctcgcctgacctggctggtctccctcttt
ggggagctttctcttgtgtctgccactttggaagagcgaaaggaagatcagtatatgaaa
atgacagtgtgtctggagacagagaagaaaagtccactgtcatggattgaagaaaaagga
cctggtctaaaacgaaacagatatttaagcttccatttcaagtctgggtccttggagaat
gtgccaaatgtaggagtgaataagaacatatttctgaaagatcaaaatatatttgtccag
aaactgttgggccagttctctgagaaggaactggctgctgaaaagaaacgcatcctgcac
tgcctggggcttgcagaagaaatccagaaatattgctgttcaaggaagtaa

DBGET integrated database retrieval system