KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101146131Help
Entry
101146131         CDS       T02442                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04010  MAPK signaling pathway
ggo04060  Cytokine-cytokine receptor interaction
ggo04068  FoxO signaling pathway
ggo04144  Endocytosis
ggo04218  Cellular senescence
ggo04350  TGF-beta signaling pathway
ggo04380  Osteoclast differentiation
ggo04390  Hippo signaling pathway
ggo04520  Adherens junction
ggo04659  Th17 cell differentiation
ggo04926  Relaxin signaling pathway
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo05142  Chagas disease (American trypanosomiasis)
ggo05166  HTLV-I infection
ggo05200  Pathways in cancer
ggo05202  Transcriptional misregulation in cancer
ggo05210  Colorectal cancer
ggo05212  Pancreatic cancer
ggo05220  Chronic myeloid leukemia
ggo05225  Hepatocellular carcinoma
ggo05226  Gastric cancer
Module
ggo_M00680  TGF-beta signaling
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101146131 (TGFBR2)
   04350 TGF-beta signaling pathway
    101146131 (TGFBR2)
   04390 Hippo signaling pathway
    101146131 (TGFBR2)
   04068 FoxO signaling pathway
    101146131 (TGFBR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101146131 (TGFBR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    101146131 (TGFBR2)
  Cell growth and death
   04218 Cellular senescence
    101146131 (TGFBR2)
  Cellular community - eukaryotes
   04520 Adherens junction
    101146131 (TGFBR2)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    101146131 (TGFBR2)
  Endocrine system
   04926 Relaxin signaling pathway
    101146131 (TGFBR2)
  Development
   04380 Osteoclast differentiation
    101146131 (TGFBR2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101146131 (TGFBR2)
   05202 Transcriptional misregulation in cancers
    101146131 (TGFBR2)
   05210 Colorectal cancer
    101146131 (TGFBR2)
   05212 Pancreatic cancer
    101146131 (TGFBR2)
   05225 Hepatocellular carcinoma
    101146131 (TGFBR2)
   05226 Gastric cancer
    101146131 (TGFBR2)
   05220 Chronic myeloid leukemia
    101146131 (TGFBR2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101146131 (TGFBR2)
  Infectious diseases
   05166 HTLV-I infection
    101146131 (TGFBR2)
   05142 Chagas disease (American trypanosomiasis)
    101146131 (TGFBR2)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101146131 (TGFBR2)
Protein kinases [BR:ggo01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   101146131 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ecTbetaR2 Pkinase_Tyr Pkinase Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 101146131
NCBI-ProteinID: XP_004033838
Ensembl: ENSGGOG00000016911
UniProt: A0A2I2Z3A0
Position
3
AA seq 567 aa AA seqDB search
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFST
CDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPK
CIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAI
SVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAH
LHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgggggctgctcaggggcctgtggccgctgcacatcgtcctgtggacgcgtatc
gccagcacgatcccaccgcacgttcagaagtcggttaataacgacatgatagtcactgac
aacaatggtgcagtcaagtttccacaactgtgtaaattttgtgatgtgagattttccacc
tgtgacaaccagaaatcctgcatgagcaactgcagcatcacctccatctgtgagaagcca
caggaagtctgtgtggctgtatggagaaagaatgacgagaacataacactagagacagtt
tgccatgaccccaagctcccctaccatgactttattctggaagatgctgcttctccaaag
tgcattatgaaggaaaaaaaaaagcctggtgagactttcttcatgtgttcctgtagctct
gatgagtgcaatgacaacatcatcttctcagaagaatataacaccagcaatcctgacttg
ttgctagtcatatttcaagtgacaggcatcagcctcctgccaccactgggagttgccata
tctgtcatcatcatcttctactgctaccgcgttaaccggcagcagaagctgagttcaacc
tgggaaaccggcaagacgcggaagctcatggagttcagcgagcactgtgccatcatcctg
gaagatgaccgctctgacatcagctccacgtgcgccaacaacatcaaccacaacacagag
ctgctgcccattgagctggacaccctggtggggaaaggtcgctttgctgaggtctataag
gccaagctgaagcagaacacttcagagcagtttgagacagtggcagtcaagatctttccc
tatgaggagtatgcctcttggaagacagagaaggacatcttctcagacatcaatctgaag
catgagaacatactccagttcctgacggctgaggagcggaagacggagttggggaaacag
tactggctgatcaccgccttccacgccaagggcaacctacaggagtacctgacgcggcat
gtcatcagctgggaggacctgcgcaagctgggcagctccctcgcccgggggattgctcac
ctccacagtgatcacactccatgtgggaggcccaagatgcccatcgtgcacagggacctc
aagagctccaatatcctcgtgaagaacgacctaacctgctgcctgtgtgactttgggctt
tccctgcgtctggaccctactctgtctgtggatgacttggctaacagtgggcaggtggga
actgcaagatacatggctccagaagtcctagaatccaggatgaatttggagaatgttgag
tccttcaagcagaccgatgtctactccatggctctggtgctctgggaaatgacatctcgt
tgtaatgcagtgggagaagtaaaagattatgagcctccatttggttccaaggtgcgggag
cacccctgtgtcgaaagcatgaaggacaacgtgttgagagatcgagggcgaccagaaatt
cccagcttctggctcaaccaccagggcatccagatggtgtgtgagacgttgactgagtgc
tgggaccacgacccagaggcccgtctcacagcccagtgtgtggcagaacgctttagtgaa
ctggagcatctggacaggctctcggggaggagctgctcggaggagaagattcctgaagac
ggctccctaaacactaccaaatag

DBGET integrated database retrieval system