KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101146137
Entry
101146137         CDS       T02442                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ggo01009]
    101146137 (AKAP5)
Protein phosphatases and associated proteins [BR:ggo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     101146137 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 101146137
NCBI-ProteinID: XP_004055341
Ensembl: ENSGGOG00000025861
UniProt: G3SEG4
Position
14
AA seq 427 aa
METTISEIHVENKDEKRSAEGSPGAERQKEKASMLCFKRRKKAAKALKPKAGSEAADVAR
KCPQEAGASDQPEPTRGAWASLKCLVTRRKRSGSSKQQKPLEAEMQPAINAEDADLSKKK
AKSRLKIPCIKFPRGPKRSNHSKIIEDSDCSIKVQEEAEILDIQTQTPLNDQATKAKSTQ
DLSEGISRKDGDEVCESNVSNSITSGEKVISVELGLDNGHSAIQTGTLILEEIETIKEKQ
DVQPQQASPLETSETDHQQPVLSDVPPLPAIPDQQIVEEASNSTLESAPNGKDYESTEIV
AEETKPEDTELSQESDFKENGITEEKSKSEESKRMEPIAIIITDTEISEFDVTKSKNVPK
QFLISTENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDN
KINNLLQ
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggaaaccacaatttcagaaattcatgtagaaaacaaggatgagaagagatcagcagaa
ggtagtcctggggctgaaaggcagaaggaaaaggcatccatgctttgcttcaagagaaga
aagaaagcagccaaagcactgaagcccaaagctggctctgaagctgctgatgtggcaagg
aagtgtccacaagaagcaggagcttctgatcagccagagcccacacggggggcctgggcc
tcactcaaatgtcttgtaacacgcaggaaaaggtcagggtcttcaaagcagcaaaagcca
ttggaggctgaaatgcaacctgcaataaatgctgaggatgctgatctttctaagaaaaag
gcaaaatctagacttaagattccctgcataaaattcccaagagggccaaaaaggagtaat
cattccaaaattatagaagactcagactgcagcatcaaagtccaggaagaagctgaaatt
ttggatatacaaacacagaccccattgaatgatcaggcaacaaaggctaagtcaacccag
gatctaagtgaaggcatctcacggaaagatggtgatgaggtctgtgaatcaaatgtgagc
aatagcataacttctggagagaaagtgatttcagtagaacttggattagataatgggcat
tctgctattcaaacgggaactctaatccttgaagaaattgaaacaatcaaggaaaaacaa
gatgttcaaccccagcaagcaagcccacttgaaacttcagaaacagaccatcagcagcca
gtactttctgatgttcctcctttacctgcaattccagatcaacaaattgtggaagaagcc
agtaacagtaccctagaaagtgcaccaaatggaaaagactatgaaagtacagagattgta
gctgaagaaactaagccagaagatactgaattgagccaagaatcagattttaaagaaaat
gggatcactgaagagaaatccaaatcagaagaaagcaaaagaatggagccaattgctatt
attattacagacactgaaatcagtgaatttgatgttacaaaatctaaaaatgtccctaag
caattcttaatttcaactgaaaatgagcaagtaggggtttttgctaatgataatggtttt
gaggatagaacttcagaacaatatgaaacactcttaattgaaacagcctcttctctcgtc
aagaatgctattcagttgtcaatagaacagctggttaatgaaatggcctctgatgataat
aaaataaacaatcttctacagtga

DBGET integrated database retrieval system