KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101146434Help
Entry
101146434         CDS       T02442                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00562  Inositol phosphate metabolism
ggo01521  EGFR tyrosine kinase inhibitor resistance
ggo01522  Endocrine resistance
ggo01524  Platinum drug resistance
ggo04012  ErbB signaling pathway
ggo04014  Ras signaling pathway
ggo04015  Rap1 signaling pathway
ggo04024  cAMP signaling pathway
ggo04062  Chemokine signaling pathway
ggo04066  HIF-1 signaling pathway
ggo04068  FoxO signaling pathway
ggo04070  Phosphatidylinositol signaling system
ggo04071  Sphingolipid signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04140  Autophagy - animal
ggo04150  mTOR signaling pathway
ggo04151  PI3K-Akt signaling pathway
ggo04152  AMPK signaling pathway
ggo04210  Apoptosis
ggo04211  Longevity regulating pathway
ggo04213  Longevity regulating pathway - multiple species
ggo04218  Cellular senescence
ggo04360  Axon guidance
ggo04370  VEGF signaling pathway
ggo04380  Osteoclast differentiation
ggo04510  Focal adhesion
ggo04550  Signaling pathways regulating pluripotency of stem cells
ggo04611  Platelet activation
ggo04620  Toll-like receptor signaling pathway
ggo04625  C-type lectin receptor signaling pathway
ggo04630  Jak-STAT signaling pathway
ggo04650  Natural killer cell mediated cytotoxicity
ggo04660  T cell receptor signaling pathway
ggo04662  B cell receptor signaling pathway
ggo04664  Fc epsilon RI signaling pathway
ggo04666  Fc gamma R-mediated phagocytosis
ggo04668  TNF signaling pathway
ggo04670  Leukocyte transendothelial migration
ggo04722  Neurotrophin signaling pathway
ggo04725  Cholinergic synapse
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04810  Regulation of actin cytoskeleton
ggo04910  Insulin signaling pathway
ggo04914  Progesterone-mediated oocyte maturation
ggo04915  Estrogen signaling pathway
ggo04917  Prolactin signaling pathway
ggo04919  Thyroid hormone signaling pathway
ggo04923  Regulation of lipolysis in adipocytes
ggo04926  Relaxin signaling pathway
ggo04930  Type II diabetes mellitus
ggo04931  Insulin resistance
ggo04932  Non-alcoholic fatty liver disease (NAFLD)
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo04960  Aldosterone-regulated sodium reabsorption
ggo04973  Carbohydrate digestion and absorption
ggo05100  Bacterial invasion of epithelial cells
ggo05142  Chagas disease (American trypanosomiasis)
ggo05146  Amoebiasis
ggo05160  Hepatitis C
ggo05161  Hepatitis B
ggo05162  Measles
ggo05163  Human cytomegalovirus infection
ggo05164  Influenza A
ggo05165  Human papillomavirus infection
ggo05166  HTLV-I infection
ggo05167  Kaposi's sarcoma-associated herpesvirus infection
ggo05169  Epstein-Barr virus infection
ggo05200  Pathways in cancer
ggo05203  Viral carcinogenesis
ggo05205  Proteoglycans in cancer
ggo05210  Colorectal cancer
ggo05211  Renal cell carcinoma
ggo05212  Pancreatic cancer
ggo05213  Endometrial cancer
ggo05214  Glioma
ggo05215  Prostate cancer
ggo05218  Melanoma
ggo05220  Chronic myeloid leukemia
ggo05221  Acute myeloid leukemia
ggo05222  Small cell lung cancer
ggo05223  Non-small cell lung cancer
ggo05224  Breast cancer
ggo05225  Hepatocellular carcinoma
ggo05226  Gastric cancer
ggo05230  Central carbon metabolism in cancer
ggo05231  Choline metabolism in cancer
ggo05418  Fluid shear stress and atherosclerosis
Module
ggo_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101146434 (PIK3CD)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    101146434 (PIK3CD)
   04015 Rap1 signaling pathway
    101146434 (PIK3CD)
   04012 ErbB signaling pathway
    101146434 (PIK3CD)
   04370 VEGF signaling pathway
    101146434 (PIK3CD)
   04630 Jak-STAT signaling pathway
    101146434 (PIK3CD)
   04668 TNF signaling pathway
    101146434 (PIK3CD)
   04066 HIF-1 signaling pathway
    101146434 (PIK3CD)
   04068 FoxO signaling pathway
    101146434 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    101146434 (PIK3CD)
   04072 Phospholipase D signaling pathway
    101146434 (PIK3CD)
   04071 Sphingolipid signaling pathway
    101146434 (PIK3CD)
   04024 cAMP signaling pathway
    101146434 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    101146434 (PIK3CD)
   04152 AMPK signaling pathway
    101146434 (PIK3CD)
   04150 mTOR signaling pathway
    101146434 (PIK3CD)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    101146434 (PIK3CD)
  Cell growth and death
   04210 Apoptosis
    101146434 (PIK3CD)
   04218 Cellular senescence
    101146434 (PIK3CD)
  Cellular community - eukaryotes
   04510 Focal adhesion
    101146434 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    101146434 (PIK3CD)
  Cell motility
   04810 Regulation of actin cytoskeleton
    101146434 (PIK3CD)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101146434 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    101146434 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    101146434 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    101146434 (PIK3CD)
   04660 T cell receptor signaling pathway
    101146434 (PIK3CD)
   04662 B cell receptor signaling pathway
    101146434 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    101146434 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    101146434 (PIK3CD)
   04670 Leukocyte transendothelial migration
    101146434 (PIK3CD)
   04062 Chemokine signaling pathway
    101146434 (PIK3CD)
  Endocrine system
   04910 Insulin signaling pathway
    101146434 (PIK3CD)
   04923 Regulation of lipolysis in adipocyte
    101146434 (PIK3CD)
   04915 Estrogen signaling pathway
    101146434 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    101146434 (PIK3CD)
   04917 Prolactin signaling pathway
    101146434 (PIK3CD)
   04926 Relaxin signaling pathway
    101146434 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    101146434 (PIK3CD)
  Digestive system
   04973 Carbohydrate digestion and absorption
    101146434 (PIK3CD)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101146434 (PIK3CD)
  Nervous system
   04725 Cholinergic synapse
    101146434 (PIK3CD)
   04722 Neurotrophin signaling pathway
    101146434 (PIK3CD)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101146434 (PIK3CD)
  Development
   04360 Axon guidance
    101146434 (PIK3CD)
   04380 Osteoclast differentiation
    101146434 (PIK3CD)
  Aging
   04211 Longevity regulating pathway - mammal
    101146434 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    101146434 (PIK3CD)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101146434 (PIK3CD)
   05230 Central carbon metabolism in cancer
    101146434 (PIK3CD)
   05231 Choline metabolism in cancer
    101146434 (PIK3CD)
   05205 Proteoglycans in cancer
    101146434 (PIK3CD)
   05203 Viral carcinogenesis
    101146434 (PIK3CD)
   05210 Colorectal cancer
    101146434 (PIK3CD)
   05212 Pancreatic cancer
    101146434 (PIK3CD)
   05225 Hepatocellular carcinoma
    101146434 (PIK3CD)
   05226 Gastric cancer
    101146434 (PIK3CD)
   05214 Glioma
    101146434 (PIK3CD)
   05221 Acute myeloid leukemia
    101146434 (PIK3CD)
   05220 Chronic myeloid leukemia
    101146434 (PIK3CD)
   05218 Melanoma
    101146434 (PIK3CD)
   05211 Renal cell carcinoma
    101146434 (PIK3CD)
   05215 Prostate cancer
    101146434 (PIK3CD)
   05213 Endometrial cancer
    101146434 (PIK3CD)
   05224 Breast cancer
    101146434 (PIK3CD)
   05222 Small cell lung cancer
    101146434 (PIK3CD)
   05223 Non-small cell lung cancer
    101146434 (PIK3CD)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101146434 (PIK3CD)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101146434 (PIK3CD)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101146434 (PIK3CD)
   04931 Insulin resistance
    101146434 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101146434 (PIK3CD)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    101146434 (PIK3CD)
   05166 HTLV-I infection
    101146434 (PIK3CD)
   05162 Measles
    101146434 (PIK3CD)
   05164 Influenza A
    101146434 (PIK3CD)
   05161 Hepatitis B
    101146434 (PIK3CD)
   05160 Hepatitis C
    101146434 (PIK3CD)
   05163 Human cytomegalovirus infection
    101146434 (PIK3CD)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101146434 (PIK3CD)
   05169 Epstein-Barr virus infection
    101146434 (PIK3CD)
   05165 Human papillomavirus infection
    101146434 (PIK3CD)
   05146 Amoebiasis
    101146434 (PIK3CD)
   05142 Chagas disease (American trypanosomiasis)
    101146434 (PIK3CD)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    101146434 (PIK3CD)
   01524 Platinum drug resistance
    101146434 (PIK3CD)
   01522 Endocrine resistance
    101146434 (PIK3CD)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101146434 (PIK3CD)
Membrane trafficking [BR:ggo04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101146434 (PIK3CD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_rbd PI3K_p85B PI3K_C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 101146434
NCBI-ProteinID: XP_018866251
Ensembl: ENSGGOG00000012386
UniProt: A0A2I2ZMF3
Position
1
AA seq 1044 aa AA seqDB search
MPPGVDCPMEFWTKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFH
MLSGPEAYVFTCINQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLCDPEVNDFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARTWGP
GTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
AKPPPIPAKKPSSVSLWSLEQPFRIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSS
SEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAP
HPVYYPALEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQE
HFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKLSSQKTPKPQTKELMHLCMR
QEAYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSGSSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLRSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atgccccctggggtggactgccccatggaattctggaccaaggaggagaatcagagcgtc
gtggttgacttcctgctgcccacaggggtctacctgaacttccctgtgtcccgcaatgcc
aacctcagcaccatcaagcagctgctgtggcaccgcgcccagtatgagccgctcttccac
atgctcagtggccccgaggcctatgtgttcacctgcatcaaccagacagcggagcagcaa
gagttggaggacgagcaacggcgtctgtgtgacgtgcagcccttcctgcccgtcctgcgc
ctggtggcccgtgagggcgaccgcgtgaagaagctcatcaactcacagatcagcctcctc
atcggcaaaggcctccacgagtttgactccttgtgcgacccagaagtgaacgactttcgc
gccaagatgtgccaattctgcgaggaggcggccgcccgccggcagcagctgggctgggag
gcctggctgcagtacagtttccccctgcagctggagccctcagctcgaacctgggggcct
ggcaccctgcggctcccgaaccgggcccttctggtcaacgttaagtttgagggcagcgag
gaaagcttcaccttccaggtgtccaccaaggatgtgccgctggcgctgatggcctgtgcc
ctgcggaagaaggccacggtgttccggcagccgctggtggagcagccagaagactacacg
ctgcaggtgaacggcaggcatgagtacctgtatggcagctacccgctctgccagttccag
tacatctgcagctgcctgcacagtgggttgacccctcacctgaccatggtccattcctcc
tccatcctcgccatgcgggatgagcagagcaaccctgcaccccaggtccagaaaccgcgt
gccaaaccacctcccattcctgcgaagaagccttcctctgtgtccctgtggtccctggag
cagccgttccgcatcgagctcatccagggcagcaaagtgaacgccgacgagcggatgaag
ctggtggtgcaggccgggcttttccacggcaacgagatgctgtgcaagacggtgtccagc
tcggaggtgagcgtgtgctcggagcccgtgtggaagcagcggctggagttcgacatcaac
atctgcgacctgccccgcatggcccgtctctgctttgcgctgtacgccgtgatcgagaaa
gccaagaaggctcgctccaccaagaagaagtccaagaaggcggactgccccattgcctgg
gccaacctcatgctgtttgactacaaggaccagcttaagaccggggaacgctgcctctac
atgtggccctccgtcccagatgagaagggcgagctgctgaaccccacgggcactgtgcgc
agtaaccccaacacggatagcgccgccgccctgctcatctgcctgcccgaggtggccccg
caccccgtgtactaccccgccctggagaagatcttggagctggggcgacacagcgagtgt
gtgcatgtcaccgaggaggagcagctgcagctgcgggaaatcctggagcggcgggggtct
ggggagctgtatgagcacgagaaggacctggtgtggaagctgcggcatgaagtccaggag
cacttcccggaggcgctagcccggctgctgctggtcaccaagtggaacaagcatgaggat
gtggcccagatgctctacctgctgtgctcctggccggagctgcccgtcctgagcgccctg
gagctgctagacttcagcttccccgattgccacgtaggctccttcgccatcaagtcgctg
cggaaactgacggacgatgagctgttccagtacctgctgcagctggtgcaggtgctcaag
tacgagtcctacctggactgcgagctgaccaaattcctgctggaccgggccctggccaac
cgcaagatcggccacttccttttctggcacctccgctccgagatgcacgtgccgtcggtg
gccctgcgcttcggcctcatcctggaggcctactgcaggggcagcacccaccacatgaag
gtgctgatgaagcagggggaagcactgagcaaactgaaggccctgaatgacttcgtcaag
ctgagctctcagaagacccccaagccccagaccaaggagctgatgcacttgtgcatgcgg
caggaggcctacctagaggccctctcccacctgcagtccccactcgaccccagcaccctg
ctggctgaagtctgcgtggagcagtgcaccttcatggactccaagatgaagcccctgtgg
atcatgtacagcaacgaggaggcaggcagtggcagcagcgtgggcatcatctttaagaat
ggggatgacctccggcaggacatgctgaccctgcagatgatccagctcatggacgtcctg
tggaagcaggaggggctggacctgaggatgaccccctacggctgcctccccaccggggac
cgcacaggcctcattgaggtggtactccgttcagacaccatcgccaacatccaactcaac
aagagcaacatggcagccacagccgccttcaacaaggacgccctgctcaactggctgaag
tccaagaacccgggggaggccctggatcgagccattgaggagttcaccctctcctgtgct
ggctattgtgtggccacatacgtgctgggcattggcgatcggcacagcgacaacatcatg
atccgagagagtgggcagctgttccacattgattttggccactttctggggaatttcaag
accaagtttggaatcaaccgcgagcgtgtcccattcatcctcacctatgactttgtccat
gtgattcagcaggggaagactaataatagtgagaaatttgaacggttccggggctactgt
gaaagggcctacaccatcctgcggcgccacgggcttctcttcctccacctctttgccctg
atgcgggcggcaggcctgcctgagctcagctgctccaaagacatccagtatctcaaggac
tccctggcactggggaaaacagaggaggaggcactgaagcacttccgagtgaagtttaac
gaagccctccgtgagagctggaaaaccaaagtgaactggctggcccacaacgtgtccaaa
gacaacaggcagtag

DBGET integrated database retrieval system