KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101146831Help
Entry
101146831         CDS       T02442                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00561  Glycerolipid metabolism
ggo01100  Metabolic pathways
ggo04714  Thermogenesis
ggo04723  Retrograde endocannabinoid signaling
ggo04923  Regulation of lipolysis in adipocytes
Module
ggo_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    101146831 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    101146831 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101146831 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    101146831 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ggo01002]
    101146831 (MGLL)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101146831 (MGLL)
Peptidases [BR:ggo01002]
 Serine Peptidases
  Family S33
   101146831 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Abhydrolase_3 DLH PGAP1 Abhydrolase_5 Thioesterase LIDHydrolase BAAT_C Abhydrolase_2 DUF1057 DUF1350 DUF2974
Motif
Other DBs
NCBI-GeneID: 101146831
NCBI-ProteinID: XP_004036296
Ensembl: ENSGGOG00000000179
UniProt: A0A2I2ZCH9
Position
3
AA seq 314 aa AA seqDB search
METGPEDPSSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSH
GAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQK
DYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNL
VLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTV
PFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMW
VSQRTATAGTASPP
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggacctgaagacccttcttccagcatgccagaggaaagttcccccaggcgg
accccgcagagcattccctaccaggacctccctcacctggtcaatgcagacggacagtac
ctcttctgcaggtactggaaacccacaggcacacccaaggccctcatctttgtgtcccat
ggagccggagagcacagtggccgctacgaagagctggctcggatgctgatggggctggac
ctgctggtgttcgcccacgaccatgttggccacggacagagcgaaggggagaggatggta
gtgtctgacttccacgttttcgtcagggatgtgttgcagcatgtggattccatgcagaaa
gactaccctgggcttcctgtcttccttctgggccactccatgggaggcgccatcgccatc
ctcacggccgcagagaggccaggccacttcgccggcatggtactcatttcgcctctggtt
cttgccaatcctgaatctgcaacaactttcaaggtccttgctgcgaaagtgctcaacctt
gtgctgccaaacttgtccctcgggcccatcgactccagcgtgctctctcggaataagaca
gaggtcgacatttataactcagaccccctgatctgccgggcagggctgaaggtgtgcttt
ggcatccaactgctgaatgccgtctcacgggtggagcgcgccctccccaagctgactgtg
cccttcctgctgctccagggctctgccgatcgcctgtgtgacagcaaaggggcctacctg
ctcatggagttagccaagagccaggacaagactctcaagatttatgaaggtgcctaccat
gttctccacaaggagcttcctgaagtcaccaactccgtcttccatgaaataaacatgtgg
gtctctcaaaggacagccacggcaggaactgcgtccccaccctga

DBGET integrated database retrieval system