KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101147112
Entry
101147112         CDS       T02442                                 

Gene name
ANKRD12
Definition
(RefSeq) ankyrin repeat domain-containing protein 12 isoform X1
  KO
K21436  ankyrin repeat domain-containing protein 11/12
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ggo03036]
    101147112 (ANKRD12)
Chromosome and associated proteins [BR:ggo03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Other HDAC associated proteins
     101147112 (ANKRD12)
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank Ank_3
Other DBs
NCBI-GeneID: 101147112
NCBI-ProteinID: XP_004059222
Ensembl: ENSGGOG00000015949
UniProt: G3SDW9
Position
18
AA seq 2062 aa
MPKSGFTKPVQSENSDSDSNMVEKPYGRKSKDKIASYSKTPKIERSDVSKEMKEKSSMKR
KLPFTISPSRNEERDSDTDSDPGHTSENWGERLISSYRTYSEKEGPEKKKTKKEAGNKKS
TPVSILFGYPLSERKQMALLMQMTARDNSPDSTPNHPSQTTPAQKKTPSSSSRQKDKVNK
RNERGETPLHMAAIRGDVKQVKELISLGANVNVKDFAGWTPLHEACNVGYYDVAKILIAA
GADVNTQGLDDDTPLHDSASSGHRDIVKLLLRHGGNPFQANKHGERPVDVAETEELELLL
KREVPLSDDDESYTDSEEAQSVNPSSVDENIDSETEKDSLICESKQILPSKTPLPSALDE
YEFKDDDDEEINKMIDDRHILRKEQRKENEPEAEKTHLFAKQEKAFYPKSFKSKKQKPSR
VLYSSTESSDEEALQNKKISTSCSIIPETSNSDIQTKKEYVVSGEHKQKGKVKRKLKNQN
KNKENQELKQEKEGKENTRITNLTVNTGLDCSEKTREEGNFRKSFSPKDDSSLHLFHIST
GKSPKHSCGLSEKQSTPLKQEHTKTCLSPGSSEMSLQPDLVRYDNAESEFLPESSSVKSC
KHKEKSKHQKDFHLEFGEKSNAKIKDEDHSPTFENSDCTLKKMDKEGKTLKKHKLKHKER
EKEKHKKEIEGEKEKYKTKDSAKELQRSVEFDREFWKENFFKSDETEDLFLNMEHESLTL
EKKSKLEKNIKDDKSTKEKHVSKERNFKEERDKIKKESEKSFREEKIKDLKEERENIPTD
KDSEFTSLGMSAIEESIGLHLVEKEIDIEKQEKHIKESKEKPEKRSQTKEKDIEKMERKN
FEKEKKIKHEHKSEKDKLDLSECVDKIKEKDKLYSHHTEKCHKEGEKSKNTAAIKKTDDR
EKSREKMDRKHDKEKPEKERHLAESKEKHLMEKKNKQSDNSEYSKSEKGKNKEKDRELDK
KEKSRDKESINITNSKHIQEEKKSSIVDGNKAQHEKPLSLKEKTKDEPLKTPDGKEKDKK
DKDIDRYKERDKHKDKIQLNSLLKLKSEADKPKPKSSPASKDTRPKEKRLVNDDLMQTSF
ERMLSLKDLEIEQWHKKHKEKIKQKEKERLRNRNCLELKIKDKEKTKHTPTESKNKELTR
SKSSEVTDAYTKEKQPKDAVSNRSQSVDTKNVMTLGKSSFVSDNSLNRSPRSENEKPGLS
SRSVSMISVASSEDSCHTTVTTPRPPVEYDSDFMLESSESQMSFSQSPFLSIAKSPALHE
RELDSLADLPERIKPPYANRLSTSHLRSSSVEDVKLIISEGRPTVEVRRCSMPSVICEHT
KQFQTISEESNQGSLLTVPRDTSPSPKPEVFSNVPERDLSNVSNIHSSFATSPTGASNSK
YVSADRNLIKNTAPVSTVMDSPVHLEPSSQVGVIQNKSWEMPVDRLETLSTRDFICPNSN
IPDQESSLQSFCNSENKILKENADFLSLRQTELPGNSCAQDPASFMPPQQPCSFPSQSLS
DAESISKHMSLSYVANQEPGILQQKNAVQIISSALDTDNESTKDTENTFVLGDVQKTDAF
VPVYSDSTIQEASPNFEKAYTLPVLPSEKDFNGSDASTQLNTHYAFSKLTYKSSSGHEVE
NSTTDTQVISREKEDKLESLVLTHLNRCDSDLCEMNAGMPKGNLNEQDPKHCPESEKCLL
SIEDEESQQSILSSLENHSQQSAQPEMHKYGQLVKVELEENAEDDKTENQIPQRMTRNKA
NTMANQSKQILASCTLLSEKDSESSSPRGRIRLTEDDDPQIHHPRKRKVSRVPQPVQVSP
SLLQAKEKTQQSLAAIVDSLKLDEIQPYSSERANPYFEYLHIRKKIEEKRKLLCSVIPQA
PQYYDEYVTFNGSYLLDGNPLSKICIPTITPPPSLSDPLKELFRQQEVVRMKLRLQHSIE
REKLIVSNEQEVLRVHYRAARTLANQTLPFSACTVLLDAEVYNVPLDSQSDDSKTSVRDR
FNARQFMSWLQDVDDKFDKLKTCLLMRQQHEAAALNAVQRLEWQLKLQELDPATYKSISI
YEIQEFYVPLVDVNDDFELTPI
NT seq 6189 nt   +upstreamnt  +downstreamnt
atgcccaaatctgggttcacaaaaccagttcagagtgaaaattctgacagtgacagcaat
atggtagagaaaccatatggaagaaagagtaaagacaagattgcatcctacagcaaaact
ccaaaaattgaacgaagtgatgtgagcaaggagatgaaagagaaatcatccatgaaacgt
aaacttccttttaccattagcccatcaagaaatgaagaacgagattcagacacagattca
gatccaggacatacaagtgaaaattggggggagagacttatatcttcttacaggacatac
tcagagaaagaaggtccagagaagaagaagacaaaaaaggaagctggaaataagaaatcc
acaccagttagcattctttttggttatccactctctgagcgaaaacagatggcacttctt
atgcagatgacagcaagagacaacagtccagattccacaccaaatcatccatcacaaaca
acgcctgcccaaaagaaaactcccagttcttcatctcgacagaaagataaagttaataaa
agaaatgaacgtggtgaaactcctttacacatggctgctattcgaggagatgtgaaacaa
gttaaagaattaataagtttaggggcaaatgtgaatgtgaaagattttgcaggttggaca
ccactgcatgaagcttgcaatgttggatattacgatgttgctaagatacttatagccgct
ggagcagatgttaacacacaaggattagatgatgacactccactccatgattctgctagt
agtgggcacagagatatagtaaagctgttacttcgtcacggtggaaatccatttcaagct
aataaacatggggagcgtccagtggatgtagcagaaacagaggagttggagttgctacta
aaaagagaggtgcctttatctgatgatgatgaaagttacacagattccgaagaggctcaa
tctgtaaatccttctagtgttgatgaaaatattgactctgaaacagagaaagactctctc
atctgtgaaagtaaacagatacttcccagtaaaacacctcttccatctgcccttgatgag
tatgagttcaaagatgatgatgatgaagaaattaataagatgattgatgataggcatatt
cttaggaaagaacaacgaaaagaaaatgaacctgaagcagaaaaaactcatttatttgca
aaacaggagaaagccttctatcctaaatcatttaaaagtaaaaaacaaaagccatctagg
gtcttatattcaagtactgaaagttctgatgaagaagctcttcagaataaaaagatttct
acttcatgttccatcatccctgaaacatcaaattctgatatacaaaccaaaaaggaatat
gtagtttcaggtgaacacaaacagaaaggcaaagttaaaagaaaattgaaaaatcagaat
aaaaataaagagaaccaagagctaaagcaagaaaaggaaggaaaagaaaatacaagaata
acaaacttgacagtaaatactggactagattgttcagaaaagaccagagaggaggggaac
tttaggaaatcttttagcccaaaagatgattcttcattacatttatttcatatttccact
ggtaaatctcccaaacattcttgtggattaagtgaaaaacagtcaacaccactaaaacaa
gaacatactaaaacatgtttatcaccaggaagttctgaaatgtcattacagcctgatctt
gttcggtatgataatgcagaatctgaattcttgccagaaagttcaagtgtaaaatcttgt
aagcataaggaaaaaagcaaacatcagaaagatttccacttagaatttggtgaaaaatca
aatgccaaaataaaggatgaagatcatagtccaacatttgaaaattcagattgcacactg
aaaaaaatggataaagaaggtaaaacattaaaaaaacataaattgaagcataaagagagg
gaaaaagaaaagcataaaaaagaaattgaaggtgaaaaggaaaaatacaaaactaaggat
agtgccaaagaactgcagaggagtgtggaatttgatagagaattttggaaagagaatttt
tttaaaagtgatgaaactgaagatctctttttaaatatggaacatgaatccttaacatta
gaaaaaaaatcaaaattggaaaaaaacatcaaagatgataaatcaaccaaggaaaagcat
gtgtcaaaagagaggaactttaaagaggaacgagacaagattaaaaaggaaagcgagaaa
tcttttagggaggaaaaaataaaagatctaaaagaagagagagaaaacatacccacagat
aaagactcagaatttacttctttgggtatgagtgccattgaggaatctatagggcttcat
ttagtggaaaaggaaatagacattgaaaaacaagaaaagcatataaaggaaagtaaagaa
aaacctgagaagcgatctcaaactaaagaaaaggacattgagaagatggaaagaaaaaac
tttgaaaaagaaaagaagataaaacatgagcataagtcagaaaaagacaaattagatctt
agtgaatgtgttgataaaataaaagaaaaggacaagctatattcgcatcacacagaaaaa
tgccataaagaaggtgagaagagcaaaaatactgctgctattaaaaaaactgacgacaga
gagaaaagtagagaaaagatggataggaaacatgacaaagaaaagcctgaaaaagagagg
catctagcagaaagcaaagaaaagcacttgatggagaaaaaaaataaacaatcagataat
agtgaatacagtaaatcagaaaaaggcaaaaataaagaaaaagacagggagctagataaa
aaggaaaaatctagagataaagaaagtataaatataactaactccaaacacatacaggaa
gaaaaaaaatcaagtatagtagacggtaataaagcacaacatgaaaaacccttatccctt
aaagaaaaaacaaaagatgaacctttgaaaactccagatggaaaagaaaaagataaaaaa
gataaagatatagatagatacaaagaacgagacaaacataaagataaaattcaactaaat
agcttactcaaactaaaatctgaagcagataagcctaaacctaagtcatcaccagcatca
aaagatacccggcctaaagaaaagaggttagtgaatgatgatttaatgcagacaagtttt
gaacgaatgctaagccttaaagacctagaaatagaacagtggcacaaaaaacataaggaa
aaaattaagcaaaaagaaaaggaacggttgagaaaccgaaactgtttagaacttaaaata
aaagataaagaaaaaacaaagcatacaccaactgaatccaaaaataaagaacttactagg
tcaaagagttcagaagtgactgatgcatataccaaggagaaacaacctaaagatgctgta
agtaacagatcacaatctgttgacaccaaaaatgtaatgactttagggaagtcatctttt
gtttcagataatagcttaaacaggtctcctagatcagaaaatgaaaagccgggtctcagc
tccagatctgtatccatgatttctgttgctagttcagaagattcctgccatactacagtg
acaaccccaaggcctccagttgagtatgactctgactttatgttagagagttcagaatcc
caaatgtccttttcccagtcaccttttttgtcaattgccaaatctcctgctcttcatgaa
agggaattggacagcctggctgacttgccagagcggattaaaccaccatatgcaaacaga
ctttcaacatcccatcttaggtcatcttctgtagaagatgttaaactaattataagcgag
gggagacctaccgtagaagttcgaagatgtagcatgccttctgtcatttgtgaacatacc
aaacaattccaaacaatatcagaagagagcaatcaaggtagcttattaactgtgccaaga
gatactagtccttctcccaaacctgaggtattctcaaatgtgcctgaaagagacctttca
aacgtgtctaacatacattccagttttgcaacttctccaactggagcttcaaacagcaaa
tatgtttcagctgatagaaatctcatcaagaatactgccccagtgagcactgtaatggac
agtccagtgcatttagagccatctagtcaggttggtgtgatccagaataaatcatgggag
atgcctgttgatagactagagacattaagcaccagagactttatctgcccaaattctaac
atacctgatcaagaatcctctcttcagagtttttgtaattctgaaaataagatattgaaa
gaaaatgctgattttttatccctgcgccagactgaactgccaggaaactcttgtgctcag
gatccggcatcctttatgcctccacagcagccttgctctttccctagccaatcactttca
gatgctgaatcgatttctaaacatatgtctttgtcatatgttgctaatcaagagccaggt
attttacaacaaaaaaatgcagttcagattattagttctgctttagatactgataatgaa
tctacaaaagatacagaaaatacttttgtcctaggagatgttcaaaaaacagatgccttt
gtcccagtgtactctgacagcactattcaagaagcatcaccaaactttgagaaagcttat
actttacctgtgttaccatcagaaaaggactttaatggaagtgatgcctctacccagcta
aatacacattatgcatttagcaaactaacttacaagtcttccagtggccatgaagttgag
aatagcacaactgatactcaggtcatttcacgtgaaaaagaagacaaactggagagtttg
gttttaactcatttgaataggtgtgattctgatttatgtgaaatgaacgcagggatgcca
aaaggaaacctaaatgaacaagatccaaaacattgtcctgaaagtgaaaagtgtttgctt
tccatagaagatgaggaatctcaacaaagcattttatcaagtctggaaaaccattcacag
cagtcagctcaaccagaaatgcataaatatggtcagttagttaaagtagaattagaagaa
aatgccgaagatgataaaactgaaaaccaaatccctcaaagaatgaccagaaacaaagca
aatacaatggcaaatcaaagcaaacagattcttgctagctgtacactattatcagaaaaa
gacagtgaatcctcatctcctagaggaagaataagattaactgaagatgacgatcctcaa
attcaccatccacggaaaaggaaagtgtcacgtgtacctcagcctgtgcaagtgagtccc
tctttactacaagcaaaagagaaaactcagcaatctctggcagccattgtagattctcta
aaactagatgagattcagccatacagttcagagagagcaaatccatatttcgaatacttg
cacataaggaaaaaaatagaagaaaaacgcaaattactgtgtagtgtgattcctcaagca
cctcagtactatgacgaatatgtaacatttaacggatcatatctcctggatggaaacccc
ttaagcaagatttgtattcccacaattacaccaccaccttcactgtcagatccacttaaa
gagctttttcgacaacaggaagttgtaaggatgaaactacgtttgcaacacagtattgaa
agggaaaaactcattgtatccaacgaacaagaagttttgcgagttcattacagagctgca
agaacattggcaaatcaaacactgccatttagtgcttgtactgttttgctggatgccgaa
gtatacaatgtaccattggactctcagtctgatgacagtaaaacttctgtgagggatcgc
tttaatgcaagacaattcatgtcttggttacaagatgtggatgataaatttgacaaatta
aagacctgtcttttaatgaggcaacaacatgaagctgcggctttaaatgctgtccagagg
ttagaatggcagctcaaactccaggaacttgatcctgccacctataaatctatcagcatt
tacgaaatccaggagttttatgttccccttgttgatgttaacgacgactttgaattgact
cctatatag

DBGET integrated database retrieval system