KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101147183
Entry
101147183         CDS       T02442                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53 isoform X1
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ggo03036]
    101147183 (ANKRD53)
Chromosome and associated proteins [BR:ggo03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    101147183 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank Ank_5 Ank_4 Ank_3
Other DBs
NCBI-GeneID: 101147183
NCBI-ProteinID: XP_004029434
Ensembl: ENSGGOG00000009559
UniProt: G3R296
Position
2A
AA seq 551 aa
MRGAGGCVSSSPGPGPSSSPAMASAGSTARRAGSGSWHSERGEGRGARPQPTPSGSMQRA
NKVSLKATWTDAESKQPSQPLPDLADHLSAQATALATPRRPASLTPPRADPSPSEESDQT
AVDQTAIGSYYQLFAAAVGNVEWLRFCLNQSLREIPTDDKGFTAIHFAAQWGKLACLQVL
VEEYKFPVDLLTNNSQTPLHLVIHRDNTTVALPCIYYLLEKGADLNAQTCNGSTPLHLAA
RDGLLDCVKVLVQSGANVHAQDAMGYKPIDFCKIWNHRACARFLKDAMWKKDKKDFAREM
TKMKMFKSQLTLMEHNYLIEYQKEHKILREAAIRKWLHGKLHPGHSLVSNTKQAWATALC
KTPEQRESQRSRSFHPSVEARLQCIPQPTEMPKPIYRKPTVKRPTMWNVSNNPARPPTTQ
ISRSQGIRLGVHPDPTPEHDFSSFLEVRPDGHGGARLHTVDGHWVAPVPRLPFEVLLRML
YPRVWPYRMKVPQGFYPISMREVPRKRHLGDNTFWTDTLAMNLRDTFDEAFLAAVRSHQG
LPTLPSPQTNP
NT seq 1656 nt   +upstreamnt  +downstreamnt
atgcggggcgccggcgggtgtgtgagtagctcgcccggcccgggtccgagttccagcccc
gcgatggcctccgcgggcagcaccgctcggcgggcgggctcgggaagctggcactcagaa
aggggagaagggagaggtgctcggccgcagccaactccaagtggctccatgcagcgggcg
aacaaagtctccttgaaggccacctggactgacgcggagtccaagcagcccagccagccc
ctgcccgacctcgcagaccacctcagtgcgcaggcgactgccctcgccacgccgcgccgc
cctgcctcgctcaccccgccccgcgctgaccccagccccagcgaggagtctgaccagacg
gcagtggaccagacggcgatcgggagctactaccagctgtttgcagcggctgtgggcaac
gtggaatggctgcgattctgtctgaaccagagcctcagggaaatccccaccgacgacaag
ggcttcactgccatccacttcgccgcccaatggggcaagcttgcatgcctgcaggtcctg
gtagaggagtacaagtttcccgtggacctgctgaccaacaatagccagacacccctgcac
ctcgtcatccacagggataacaccaccgtggccctcccctgcatctactacctgctggag
aaaggcgcagacctcaatgctcagacatgcaacggctccacgcccctgcacctggcagcc
cgtgacggcttgctggactgtgtgaaggtcctggtgcagagtggcgccaacgtccatgcc
caagatgccatgggctacaaacccattgacttctgcaaaatatggaaccaccgtgcctgt
gcccggttcttgaaggacgccatgtggaaaaaggacaagaaggactttgcccgtgagatg
acgaaaatgaagatgttcaagagccagctgaccctcatggagcacaactacctgattgag
tatcaaaaagagcacaaaattctcagagaagctgctatcagaaagtggctccacggcaag
ctgcacccaggccactctctggtctctaataccaagcaagcctgggccaccgccctctgc
aagaccccagagcaacgggaatcgcagcgttccaggagcttccacccctctgtggaggcg
cgcctgcaatgcattccacagcccacggagatgcccaagcccatctacaggaagcccacg
gtcaagcggcccacgatgtggaatgttagcaacaaccccgccagaccccccaccactcag
atcagccgctcgcagggcatccgcctgggcgtgcatccagaccccactccggagcacgac
ttcagcagcttcctggaggtgaggcctgatgggcacggcggtgcgcggctgcacacagtg
gacggccactgggtggcgcccgtgccgcggctgccttttgaggtgctgctccgcatgctg
tacccacgtgtatggccatacagaatgaaggtgccccagggcttttaccccatcagcatg
agggaagtgcccaggaagcggcacctgggtgacaacaccttctggaccgacactctggcc
atgaacctgcgtgacacattcgatgaagccttcctggcagctgtgcgatctcatcaagga
ctccccaccctgccctccccacaaaccaacccataa

DBGET integrated database retrieval system