KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101147238Help
Entry
101147238         CDS       T02442                                 

Gene name
CPT1C
Definition
(RefSeq) carnitine palmitoyltransferase 1C
  KO
K19524  carnitine O-palmitoyltransferase 1, brain isoform [EC:2.3.1.21]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00071  Fatty acid degradation
ggo01212  Fatty acid metabolism
ggo03320  PPAR signaling pathway
ggo04152  AMPK signaling pathway
ggo04714  Thermogenesis
ggo04920  Adipocytokine signaling pathway
ggo04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101147238 (CPT1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101147238 (CPT1C)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101147238 (CPT1C)
   04920 Adipocytokine signaling pathway
    101147238 (CPT1C)
   03320 PPAR signaling pathway
    101147238 (CPT1C)
  09159 Environmental adaptation
   04714 Thermogenesis
    101147238 (CPT1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ggo03029]
    101147238 (CPT1C)
Enzymes [BR:ggo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     101147238 (CPT1C)
Mitochondrial biogenesis [BR:ggo03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    101147238 (CPT1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 101147238
NCBI-ProteinID: XP_018871003
Ensembl: ENSGGOG00000012237
Position
19
AA seq 836 aa AA seqDB search
MAEAHQAVGFRPSLTSDGAEVELSAPVLQEIYLSGLRSWKRHLSRFWNDFLTGVFPASPL
SWLFLFSAIQLAWFLQLDPSLGLMEKIKELLPDWGGQHHGLRGVLAAALFASCLWGALIF
TLHVALRLLLSYHGWLLEPHGAMSSPTKTWLALVRIFSGRHPMLFSYQRSLPRQPVPSVQ
DTVRKYLESVRPVLSDEDFDWTAVLAQEFLRLQASLLQWYLRLKSWWASNYVSDWWEEFV
YLRSRNPLMVNSNYYMMDFLYVTPTPLQAARAGNAVHALLLYRHRLNRQEIPPVRGPQWV
RDGGVVLWPLGHVGPGRQLTAHGFLQTLLMGMRPLCSAQYEKIFNTTRIPGVQKDYIRHL
HDSQHVAVFHRGRFFRMGTHSRNSLLSPRALEQQFQRILDDPSPACPHEEHLAALTAAPR
GTWAQVRTSLKTQAAEALEAVEGAAFFVSLDAEPAGLTREDPAASLDAYAHALLAGRGHD
RWFDKSFTLIVFSNGKLGLSVEHSWADCPISGHMWEFTLATECFQLGYSTDGHCKGHPDP
TLPQPQRLQWDLPDQIHSSISLALRGAKILSENVDCHVVPFSLFGKSFIRRCHLSSDSFI
QIALQLAHFRDRGQFCLTYESAMTRLFLEGRTETVRSCTREACNFVRAMEDKEKTDPQCL
ALFRVAVDKHQALLKAAMSGQGVDRHLFALYIVSQFLHLQSPFLTQVHSEQWQLSTSQIP
VQQMHLFDVHNYPDYVSSGGGFGPADDHGYGVSYIFMGDGMITFHISSKKSSTKTDSHRL
GQHIEDALLDVASLFQAGQHFKRRFRGSGKENSRHRCGFLSRQTGVSKASMTSTNF
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcgcaccaggccgtgggcttccgaccctcgctgacctcggacggggctgaa
gtggaactcagtgcccctgtgctgcaggagatctacctctctggcctgcgctcctggaaa
aggcatctctcacgtttctggaatgactttctcaccggtgtgtttcctgccagccccctc
agttggcttttcctcttcagtgccatccagcttgcctggttcctccagctggatccttcc
ttaggactgatggagaagatcaaagagttgctgcctgactggggtggacaacaccacggg
ctccggggggtcctggcagccgcgctgtttgcctcgtgtttgtggggagccctgatcttc
acactgcacgtggccctgaggctgcttctgtcctaccacggctggcttcttgagccccac
ggagccatgtcctcccccaccaagacctggctggccctggtccgcatcttctctggccgc
cacccgatgctgttcagttaccagcgctccctgccacgccagcccgtgccctctgtgcag
gacaccgtgcgcaagtacctggagtcggtccggcccgtcctctccgacgaggacttcgac
tggaccgcggtcctggcgcaggaattcctgaggctgcaggcgtcgctgctgcagtggtac
ctgcggctcaagtcctggtgggcgtccaattatgtcagtgactggtgggaggaatttgtg
tacctgcgctcccgaaatccgctgatggtgaacagcaattattacatgatggacttcctg
tatgtcacacccacgcctctgcaggcagctcgcgctgggaatgccgtccatgccctcctc
ctgtaccgccaccgcctgaaccgccaggagataccccccgtaagagggccccagtgggtt
agggatggaggtgtggtcctgtggcctttgggccacgtgggtcctggaaggcagctcaca
gcccacggtttcctgcagactttgctgatgggaatgcgccccttatgctctgcccagtac
gagaagatcttcaacaccacgcggattccaggggtccaaaaagactacatccgccacctc
catgacagccaacacgtggctgtcttccaccggggccgattcttccgcatggggacccac
tcccgaaacagcctgctttccccgagggccctggagcagcagtttcagagaatcctggat
gatccctcaccggcctgcccccacgaggaacatctggcagctctgacagctgctcccagg
ggcacgtgggcccaggtgcggacatccctgaagacccaggcagcggaggccctggaggcg
gtggaaggggccgctttctttgtgtcactggatgctgagcccgcggggctcaccagggag
gacccggcagcatcgttggatgcctacgcccatgctctgctggccggccggggccatgac
cgctggtttgacaaatccttcaccctaatcgtcttctctaacgggaagctgggcctcagc
gtggagcactcctgggccgactgccccatctcaggacacatgtgggagttcactctggct
acagaatgctttcagctgggctactcaacagacggccactgcaaggggcacccggacccc
acactaccccagccccagcggctgcaatgggaccttccagaccagatccactcctccatc
tctctagccctgaggggagccaagatcttgtctgaaaatgtcgactgccatgtcgttcca
ttctccctatttggcaagagcttcatccgacgctgccacctctcttcagacagcttcatc
cagatcgccttgcaactggcccacttccgggacaggggtcaattctgcctgacttatgag
tcggccatgactcgcttattcctggaaggccggacagagacggtgcggtcttgcacgagg
gaggcctgcaactttgtgagggccatggaggacaaagagaagacggacccacagtgcctc
gccctgttccgcgtggcagtggacaagcaccaggctctgctgaaggcagccatgagcggg
cagggagtcgaccgccacctctttgcgctgtacatcgtgtcccaattcctccacctgcag
tcgcccttcctgacccaggtccattcggagcagtggcagctgtccaccagccagatccct
gttcagcaaatgcatctgtttgacgtccacaattacccggactatgtttcctcaggcggt
ggattcgggcctgctgatgaccatggttatggtgtttcttatatcttcatgggggatggc
atgatcaccttccacatctccagcaaaaaatcaagcacaaaaacggattcccacaggctg
gggcagcacattgaggacgcactgctggatgtggcctccctgttccaggcgggacagcat
tttaagcgccggttcagagggtcagggaaggagaactccaggcacaggtgtggatttctc
tcccgccagactggggtctccaaggcatcaatgacatccaccaacttctga

DBGET integrated database retrieval system