KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101148846Help
Entry
101148846         CDS       T02442                                 

Gene name
TYR
Definition
(RefSeq) tyrosinase
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00350  Tyrosine metabolism
ggo01100  Metabolic pathways
ggo04916  Melanogenesis
Module
ggo_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    101148846 (TYR)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    101148846 (TYR)
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     101148846 (TYR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tyrosinase Laminin_EGF
Motif
Other DBs
NCBI-GeneID: 101148846
NCBI-ProteinID: XP_004051998
Ensembl: ENSGGOG00000009122
UniProt: G3R159
Position
11
AA seq 471 aa AA seqDB search
MLLAILYCLLWSFQTSAGHFPRACVSSKNLMEKECCPPWSGDRSPCGQLSGRGSCQNILL
SNAPLGPQFPFTGVDDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGFWGPNCTERRLLVR
RNIFDLSAPEKDKFFAYLTLAKHTISSDYVIPIGTYGQMKNGSTPMFNDINIYDLFVWMH
YYVSMDALLGGSEIWRDIDFAHEAPAFLPWHRLFLLRWEQEIQKLTGDENFTIPYWDWRD
AEKCDICTDEYMGGQHPTNPNLLSPASFFSSWQIVCSRLEEYNSHQSLCNGTPEGPLQRN
PGNHDKSRTPRLPSSADVEFCLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQS
SMHNALHIYMNGTMSQVQGSANDPIFLLHHAFVDSIFEQWLRRHRPLQEVYPEANAPIGH
NRESYMVPFIPLYRNSDFFISSKDLGYDYSYLQDSVSEWILFTTKATKFPG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggctattttgtactgcctgctgtggagtttccagacctccgctggccatttc
cctagagcctgtgtctcctctaagaacctgatggagaaggaatgctgtccaccgtggagc
ggggacaggagtccctgtggccagctttcaggcagaggttcctgtcagaatatccttctg
tccaatgcaccacttgggcctcaatttcccttcacaggggtggatgaccgggagtcgtgg
ccttccgtcttttataataggacctgccagtgctctggcaacttcatgggattcaactgt
ggaaactgcaagtttggcttttggggaccaaactgcacagagagacgactcttggtgaga
agaaacatcttcgatttgagtgccccagagaaggacaaattttttgcctacctcacttta
gcaaagcataccatcagctcagactacgtcatccccatagggacctatggccaaatgaaa
aatggatcaacacccatgtttaacgacatcaatatttatgacctctttgtctggatgcat
tattatgtgtcaatggatgcactgcttgggggatctgaaatctggagagacattgatttt
gcccatgaagcaccagcttttctgccctggcatagactcttcttgttgcggtgggaacaa
gaaatccagaagctgacaggagatgaaaacttcactattccatattgggactggcgggat
gcagaaaagtgtgacatttgcacagatgagtacatgggaggtcagcaccccacaaatcct
aacttactcagcccagcatcattcttctcctcttggcagattgtctgtagccgattggag
gagtacaacagccatcagtctttatgcaatggaacgcccgagggacctttgcagcgtaat
cctggaaaccatgacaaatccagaaccccaaggctcccctcttcagctgatgtagaattt
tgcctgagtttgacccaatatgaatctggttccatggataaagctgccaatttcagcttc
agaaatacactggaaggatttgctagtccacttactgggatagcagatgcctctcaaagc
agcatgcacaatgccttgcacatctatatgaatggaacaatgtcccaggtacagggatct
gccaacgatcccatcttccttcttcaccatgcatttgttgacagtatttttgagcagtgg
ctccgaaggcaccgtcctcttcaagaagtttatccggaagccaatgcacccattggacat
aaccgggaatcctacatggttccttttataccactgtacagaaacagtgatttctttatt
tcatccaaagatctgggctatgactatagctatctacaagattcagtgtccgaatggata
ctttttactacaaaggcaacaaaatttcctggatga

DBGET integrated database retrieval system