KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101149424Help
Entry
101149424         CDS       T02442                                 

Gene name
PIN4, PAR14, parvulin
Definition
(RefSeq) peptidylprolyl cis/trans isomerase, NIMA-interacting 4
  KO
K09579  peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 [EC:5.2.1.8]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ggo03110]
    101149424 (PIN4)
Enzymes [BR:ggo01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     101149424 (PIN4)
Chaperones and folding catalysts [BR:ggo03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    101149424 (PIN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rotamase_3 Rotamase Rotamase_2
Motif
Other DBs
NCBI-GeneID: 101149424
NCBI-ProteinID: XP_004064434
Ensembl: ENSGGOG00000016008
UniProt: G3RIU6
Position
X
AA seq 156 aa AA seqDB search
MPMAGLLKGLVRQLEQFRVEQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGG
NAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVATQYSEDKARQGGDLGWMTRGSMVGPFQ
EAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcccatggcggggcttctaaaggggcttgtacggcaactggagcagttcagagttgaa
caacaagcttccaagatgccgcccaaaggaaaaagtggttctggaaaagcggggaaaggg
ggagcagcctctgggagtgacagtgctgacaagaaggctcaaggtcccaaaggtggtggc
aatgcagtaaaggtcagacacattctatgtgaaaaacatggcaaaatcatggaagccatg
gaaaagttaaagtctgggatgagattcaatgaagtggccacacagtatagtgaagataaa
gccaggcaagggggcgacttgggttggatgaccagagggtccatggtgggaccatttcaa
gaagcagcatttgccttgcctgtaagtgggatggataagcctgtgtttacagacccaccg
gttaagacaaaatttggatatcatattattatggtcgaaggaagaaaataa

DBGET integrated database retrieval system