KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101149513Help
Entry
101149513         CDS       T02442                                 

Definition
(RefSeq) cytochrome P450 3A4
  KO
K17689  cytochrome P450 family 3 subfamily A polypeptide 4 [EC:1.14.13.32 1.14.14.55 1.14.14.56 1.14.14.57 1.14.14.73 1.14.13.-]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00140  Steroid hormone biosynthesis
ggo00591  Linoleic acid metabolism
ggo00830  Retinol metabolism
ggo00980  Metabolism of xenobiotics by cytochrome P450
ggo00982  Drug metabolism - cytochrome P450
ggo00983  Drug metabolism - other enzymes
ggo01100  Metabolic pathways
ggo04976  Bile secretion
ggo05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    101149513
   00591 Linoleic acid metabolism
    101149513
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101149513
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101149513
   00982 Drug metabolism - cytochrome P450
    101149513
   00983 Drug metabolism - other enzymes
    101149513
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    101149513
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    101149513
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ggo00199]
    101149513
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.32  albendazole monooxygenase
     101149513
    1.14.13.-  
     101149513
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.55  quinine 3-monooxygenase
     101149513
    1.14.14.56  1,8-cineole 2-exo-monooxygenase
     101149513
    1.14.14.57  taurochenodeoxycholate 6alpha-hydroxylase
     101149513
    1.14.14.73  albendazole monooxygenase (sulfoxide-forming)
     101149513
Cytochrome P450 [BR:ggo00199]
 Cytochrome P450, animal type
  CYP3 family
   101149513
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 101149513
NCBI-ProteinID: XP_030869030
Ensembl: ENSGGOG00000003894
Position
7
AA seq 503 aa AA seqDB search
MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNIWSYRKGFCMF
DMECHKKYGKVWGFYDGRQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISI
AEDEEWKRLRSLLSPTFTSGKLKEMVPLIAQYGDVLVRNLRLEAETGKPVTMKDVFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSIIVFPFLTPILEVLNISV
FPRAVTSFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI
IFIFAGYETTSSVLSFITYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVV
NETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHHDPKYWTEPEKFLPERFS
KKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLRLG
GLLQPEKPIVLKVESRDGTVSGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggctctcatcccagacttggccatggaaacctggcttctcctggctgtcagcctggtg
ctcctctatctatatggaacccattcacatggactttttaagaagcttggaattccaggg
cccacacctctgccttttttgggaaatatttggtcctaccgtaagggcttttgtatgttt
gacatggaatgtcataaaaagtatggaaaagtgtggggcttttatgatggtcgacagcct
gtgctggctatcacagatcctgacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggccttttggtccagtgggatttatgaaaagtgccatctctata
gctgaggatgaagaatggaagagattacgatcattgctgtctccaaccttcaccagtgga
aaactcaaggagatggtccctctcattgcccagtatggagatgtgttggtgagaaatctg
aggctggaagcagagacaggcaagcctgtcaccatgaaagacgtctttggggcctacagc
atggatgtgatcactagcacatcatttggagtgaacatcgactctctcaacaatccacaa
gacccctttgtggaaaacaccaagaagcttttaagatttgattttttggatccattcttt
ctctcaataatagtctttccattcctcaccccaattcttgaagtattaaatatctctgtg
tttccaagagcagttacaagttttttaagaaaatctgtaaaaaggatgaaagaaagtcgc
ctcgaagatacacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcaaaagaaactgagtcccacaaagctctgtccgatctggagctcgtggcccaatcaatt
atctttatttttgctggctatgaaaccacgagcagtgttctctccttcattacgtatgaa
ctggccactcaccctgatgtccagcagaaactgcaggaggaaattgatgcagttttaccc
aataaggcaccacccacctatgatactgtgctacagatggagtatcttgacatggtggtg
aatgaaacgctcagattattcccaattgctatgagacttgagagggtctgcaaaaaagat
gttgaaatcaatgggatgttcattcccaaaggggtggtggtgatgattccaagctatgct
cttcaccatgacccaaagtactggacagagcctgagaagttcctccctgaaagattcagc
aagaagaacaaggacaacatagatccttacatatatacaccctttggaagtggacccaga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctctaatcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatccccctgaaattacgcttagga
ggacttcttcaaccagaaaaacccattgttctaaaggttgagtcaagggatggcaccgta
agtggagcctga

DBGET integrated database retrieval system