KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101150249Help
Entry
101150249         CDS       T02442                                 

Gene name
HDAC8
Definition
(RefSeq) histone deacetylase 8
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo05034  Alcoholism
ggo05165  Human papillomavirus infection
ggo05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101150249 (HDAC8)
  Substance dependence
   05034 Alcoholism
    101150249 (HDAC8)
  Infectious diseases
   05165 Human papillomavirus infection
    101150249 (HDAC8)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101150249 (HDAC8)
Chromosome and associated proteins [BR:ggo03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     101150249 (HDAC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl DNase-RNase
Motif
Other DBs
NCBI-GeneID: 101150249
NCBI-ProteinID: XP_004064438
Ensembl: ENSGGOG00000011587
UniProt: A0A2I2Z4J1
Position
X
AA seq 196 aa AA seqDB search
MLTREHRCGRSEEQELEPWPSPKKARSGRWLRNGFKWKMEEPEEPADSGQSLVPVYIYSP
EYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKV
SQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAVGGATITAAQCLIDGMCKVAINWSGGWH
HAKKETCVYVALYKAF
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccagggagcaccgctgcggccgatcagaggagcaggaactggaaccctggccg
agtccgaaaaaagccagatctggaaggtggctgcggaacggttttaagtggaagatggag
gagccggaggaaccggcggacagtgggcagtcgctggtcccggtttatatctatagtccc
gagtatgtcagtatgtgtgactccctggccaagatccccaaacgggccagtatggtacat
tctttgattgaagcatatgcactgcataagcaaatgaggatagttaagcctaaagtggcc
tccatggaggagatggccaccttccacactgatgcttatctgcagcatctccagaaggtc
agccaagagggcgatgatgatcatccggactccatagaatatgggctaggttatgactgc
ccagccactgaagggatatttgactatgcagcagctgtaggaggggctacgatcacagct
gcccaatgcctgattgacggaatgtgcaaagtagcaattaactggtctggagggtggcat
catgcaaagaaagagacgtgtgtgtatgtggcactttacaaggcattctga

DBGET integrated database retrieval system