KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101151743
Entry
101151743         CDS       T02442                                 

Gene name
ESRRG
Definition
(RefSeq) estrogen-related receptor gamma isoform X4
  KO
K08554  estrogen-related receptor gamma
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ggo03000]
    101151743 (ESRRG)
   03029 Mitochondrial biogenesis [BR:ggo03029]
    101151743 (ESRRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ggo03310]
    101151743 (ESRRG)
Transcription factors [BR:ggo03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    101151743 (ESRRG)
Mitochondrial biogenesis [BR:ggo03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    101151743 (ESRRG)
Nuclear receptors [BR:ggo03310]
 3. Estrogen like
  3B. Estrogen-related receptor
   101151743 (ESRRG)
SSDB
Motif
Pfam: Hormone_recep zf-C4 GAT
Other DBs
NCBI-GeneID: 101151743
NCBI-ProteinID: XP_004028448
Ensembl: ENSGGOG00000010263
UniProt: G3R425
Position
1
AA seq 458 aa
MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGG
SSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML
NSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSC
QACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSH
LLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSL
LQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMK
LEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMT
LPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggattcggtagaactttgccttcctgaatctttttccctgcactacgaggaagagctt
ctctgcagaatgtcaaacaaagatcgacacattgattccagctgttcgtccttcatcaag
acggaaccttccagcccggcctccctgacggacagcgtcaaccaccacagccctggtggc
tcgtcagacgccagtgggagctacagttcaaccatgaatggccatcagaacggacttgac
tcgccacctctctacccttctgctcctatcctgggaggtagtgggcctgtcaggaaactg
tatgatgactgctccagcaccattgttgaagatccccagaccaagtgtgaatacatgctc
aactcgatgcccaagagactgtgtttagtgtgtggtgacatcgcttctgggtaccactat
ggggtagcatcatgtgaagcctgcaaggcattcttcaagaggacaattcaaggcaatata
gaatacagctgccctgccacgaatgaatgtgaaatcacaaagcgcagacgtaaatcctgc
caggcttgccgcttcatgaagtgtttaaaagtgggcatgctgaaagaaggggtgcgtctt
gacagagtacgtggaggtcggcagaagtacaagcgcagaatagatgcggagaacagccca
tacctgaaccctcagctggttcagccagccaaaaagccatataacaagattgtctcacat
ttgttggtggctgaaccggagaagatctatgccatgcctgaccctactgtccccgacagt
gacatcaaagccctcactacactgtgtgacttggccgaccgagagttggtggttatcatt
ggatgggcgaagcatattccaggtttctccacgctgtccctggcggaccagatgagcctt
ctgcagagtgcttggatggaaattttgatccttggtgtcgtataccggtctctttcgttt
gaggatgaacttgtctatgcagacgattatataatggacgaagaccagtccaaattagca
ggccttcttgatctaaataatgctatcctgcagctggtaaagaaatacaagagcatgaag
ctggaaaaagaagaatttgtcaccctcaaagctatagctcttgctaattcagactccatg
cacatagaagatgttgaagccgttcagaagcttcaggatgtcttacatgaggcgctgcag
gattatgaagctggccagcacatggaagaccctcgtcgagctggcaagatgctgatgaca
ctgccactcctgaggcagacctctaccaaggccgtgcagcatttctacaacatcaaacta
gaaggcaaagtccccatgcacaaactttttttggaaatgttggaggccaaggtctga

DBGET integrated database retrieval system